KEGG   Bacillus subtilis subsp. subtilis 168: BSU18070Help
Entry
BSU18070          CDS       T00010                                 

Gene name
yneS
Definition
(RefSeq) glycerol-3-phosphate acyltransferase
  KO
K08591  acyl phosphate:glycerol-3-phosphate acyltransferase [EC:2.3.1.275]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00561  Glycerolipid metabolism
bsu00564  Glycerophospholipid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU18070 (yneS)
   00564 Glycerophospholipid metabolism
    BSU18070 (yneS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU18070 (yneS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.275  acyl phosphate:glycerol-3-phosphate acyltransferase
     BSU18070 (yneS)
Lipid biosynthesis proteins [BR:bsu01004]
 Phospholipid acyltransferase
  GPAT
   BSU18070 (yneS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G3P_acyltransf
Motif
Other DBs
NCBI-GeneID: 938037
NCBI-ProteinID: NP_389689
Pasteur: BG11826
BSORF: BG11826
UniProt: Q45064
Position
complement(1931920..1932501)
Genome map
AA seq 193 aa AA seqDB search
MLIALLIILAYLIGSIPSGLIVGKLAKGIDIREHGSGNLGATNAFRTLGVKAGSVVIAGD
ILKGTLATALPFLMHVDIHPLLAGVFAVLGHVFPIFAKFKGGKAVATSGGVLLFYAPLLF
ITMVAVFFIFLYLTKFVSLSSMLTGIYTVIYSFFVHDTYLLIVVTLLTIFVIYRHRANIK
RIINKTEPKVKWL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttaattgctttattgattattttggcctacttgataggcagcattccatctggctta
attgtgggcaagcttgccaaaggaattgatattcgggagcacggaagcggcaacttaggc
gctaccaatgcattccgtacattgggtgtaaaagctggttcggtcgtcatagccggagat
attttgaaagggacactggcaactgcattgccttttctcatgcatgttgatattcacccg
cttcttgcaggagtctttgcggttttaggccacgtgtttcccatcttcgccaaatttaaa
ggcggtaaagccgtggcgacatcaggaggcgttttgctattttacgcacccctgttattt
atcacgatggttgcggtattcttcatctttttatacttgactaaatttgtttctctctca
tcgatgttaacagggatctatactgttatatatagtttctttgtccatgatacgtattta
ttgattgtcgttaccctgctcactatttttgtgatatacagacaccgagcgaacattaaa
cgaattatcaataaaacagaacctaaagtaaaatggttataa

DBGET integrated database retrieval system