KEGG   Bacillus subtilis subsp. subtilis 168: BSU18090Help
Entry
BSU18090          CDS       T00010                                 

Gene name
parE
Definition
(RefSeq) DNA topoisomerase 4 subunit B
  KO
K02622  topoisomerase IV subunit B [EC:5.6.2.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU18090 (parE)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU18090 (parE)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU18090 (parE)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     BSU18090 (parE)
DNA replication proteins [BR:bsu03032]
 Prokaryotic type
  DNA Topoisomerases
   BSU18090 (parE)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU18090 (parE)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BSU18090 (parE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3 TOPRIM_C
Motif
Other DBs
NCBI-GeneID: 936151
NCBI-ProteinID: NP_389691
Pasteur: BG11804
BSORF: BG11804
UniProt: Q59192
Position
1933477..1935444
Genome map
AA seq 655 aa AA seqDB search
MARKQQFDYNEDAIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNSVDEVLAGHGD
HIIVKIHKDNSISVQDRGRGMPTGMHKLGKPTPEVILTVLHAGGKFGQGGYKTSGGLHGV
GASVVNALSEWLTVTIERDGFVYQQRFENGGKPVTSLEKIGKTKKTGTLTHFKPDPTMFS
TTTYNFETLSERLRESAFLLKGLKIELIDERNDQREVFYYENGIEAFVAYLNEEKDVLSE
VVSFEGEHHSIEVDFAFQFNDGYSENILSFVNNVRTKDGGTHESGAKTAMTRAFNEYARK
VALLKEKDKNLEGTDIREGLSAIISVRIPEELLQFEGQTKGKLGTSEARSAVDAIVSEQL
AYFLEENRDTATLLVKKAIKASQAREAARKAREEARSGKKRKKSEATLSGKLTPAGSRNP
AKNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAKLADIFKNEEINTIIHAIG
GGVGADFSIDDINYDKIIIMTDADTDGAHIQVLLLTFFYRYMKPLIEHGKVFIALPPLYK
VSKGSGKKEIIEYAWSDEEMGDVLKKVGKGYTIQRYKGLGEMNADQLWETTMNPESRTLV
RVKIDDAARVERRVTTLMGDKVEPRRKWIEKNVAFGLDEESNILENENLSVAEEV
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
ttggctagaaaacagcaatttgattacaacgaagatgccatacaggtgctcgaaggcctt
gaggctgtcaggaaaaggccgggtatgtatattggctctactgacgcgcggggtttgcac
cacttggtttatgaaattgtagataactctgtcgacgaggtgcttgccggccatggagat
cacataatcgtcaaaatacataaagacaatagtatttctgtacaggatagaggccgcggc
atgccgaccggaatgcataagctcggcaaaccaacccctgaagtgattttaacggtgctt
catgccggagggaaattcggccaaggcggctataagacaagcggcgggctccacggagtt
ggtgcatcagtcgtgaatgctttatctgaatggctgacggttaccattgagcgggacggt
tttgtctatcagcagcgatttgaaaatggaggaaaaccggttacatctctcgaaaagatc
ggcaaaacaaaaaagacgggaactcttacacactttaagccagatccaacgatgttcagc
acaaccacttataattttgaaacgctctctgagcgcttaagagagtctgcgtttttgtta
aaaggactgaaaattgagctgattgatgaacgcaatgaccagcgtgaggtcttttattat
gaaaacggcatagaagcgtttgttgcttacttaaatgaagaaaaagacgtcttgtctgaa
gtggtctcgtttgagggtgagcatcattctatagaagtggactttgcgttccagtttaac
gatggttattctgaaaatattttgtcgtttgtcaacaatgtcagaacaaaagacggcggg
acgcatgagtcaggtgcaaaaactgcgatgacgcgtgcttttaatgaatatgcgcgaaaa
gtggctttgctgaaagaaaaggataagaaccttgaaggcaccgatataagggaagggctt
tcagccattatttctgtccgcattcctgaggagcttcttcaatttgagggacaaacaaaa
ggaaagctcggtaccagtgaagcaagatcagcggtggatgcgattgtttcagagcagctt
gcttactttttagaggaaaatcgggacaccgcaacgcttcttgtcaaaaaagcaatcaag
gcgagccaggcgcgcgaagcggcacgcaaagcccgtgaagaagcaagaagcggcaaaaaa
cgaaaaaaatcagaagcgactttaagcggaaagctgacgcctgcgggttcaagaaacccg
gcaaaaaatgaattgtatctcgttgagggagattcagcaggcgggtcagccaagcaggga
cgagaccgcagattccaggcggttctgcctttacgcggtaaagtcattaatacagaaaaa
gctaagcttgctgatatctttaaaaatgaagagatcaatacgatcattcatgcgatcggc
gggggagtcggggcagatttctcaatcgatgacatcaactacgacaaaatcatcattatg
accgatgccgatactgacggcgcccatattcaagtgctgcttcttacctttttctatcgc
tatatgaaaccgctcattgagcatggcaaggtgttcattgcgctgccacctttatataag
gtcagtaaaggaagcgggaaaaaggaaatcattgaatatgcatggtctgatgaagagatg
ggggatgtcctgaaaaaagtcggcaaaggctataccattcaacgatataagggtcttgga
gagatgaacgcagaccagctgtgggaaacgacgatgaatccggagtcccgcacacttgtt
agggtcaaaattgacgatgcggcacgtgtagagagacgtgtgacgacgttaatgggagac
aaagtagagccgcgcagaaagtggattgagaaaaacgtcgctttcggcttagatgaagaa
agcaatattttagaaaatgaaaacttatcggtcgctgaggaggtttaa

DBGET integrated database retrieval system