KEGG   Bacillus subtilis subsp. subtilis 168: BSU18100Help
Entry
BSU18100          CDS       T00010                                 

Gene name
parC
Definition
(RefSeq) DNA topoisomerase 4 subunit A
  KO
K02621  topoisomerase IV subunit A [EC:5.6.2.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU18100 (parC)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU18100 (parC)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU18100 (parC)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     BSU18100 (parC)
DNA replication proteins [BR:bsu03032]
 Prokaryotic type
  DNA Topoisomerases
   BSU18100 (parC)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU18100 (parC)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BSU18100 (parC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C FliT PspB Sec2p
Motif
Other DBs
NCBI-GeneID: 937107
NCBI-ProteinID: NP_389692
Pasteur: BG11803
BSORF: BG11803
UniProt: Q45066
Position
1935448..1937868
Genome map
AA seq 806 aa AA seqDB search
MSQPELFHDLPLEEVIGDRFGRYSKYIIQDRALPDARDGLKPVQRRILYAMHTDGNTFDK
NFRKAAKTVGNVIGNYHPHGDSSVYEAMVRMSQDWKVRNVLIEMHGNNGSIDGDPPAAMR
YTEARLSPIASELLRDIDKNTVEFVPNFDDTSKEPVVLPAMFPNLLVNGSTGISAGYATD
IPPHHLGEVIDAVIKRIQMPSCSVDELMEVIKGPDFPTGGIIQGVDGIRKAYETGKGKII
IRGKAEIETIRGGREQIVITEIPFEVNKANLVKKMDEFRIDKKVEGISEVRDETDRTGLR
VVIELKKEADAKGILNFLYKNTDLQITYNFNMVAIHNRRPMLMSLPSILDAYIGHQKEVV
TNRSVYELQKAKDRHHIVEGLMKALSILDEVIATIRSSSDKRDAKNNLIAKYEFTEPQAE
AIVSLQLYRLTNTDITALKEEAEELGKKIEELESILSNDKKLLKVITNSLKALKKKYADT
RRSVIEEKIEEIKINLEVMVASEDVYVTVTKDGYLKRTSQRSFAASNGQDFGMKDTDRML
HQFEMNTTDVLLLFTNKGSYIYCPVHQLPDIRWKDMGQHFSNLITIDRDETIVKAIPIKE
FDPSAYLLFFTKNGMVKKTELTHYKAQRYSKALVALNLKGEDELIDVHVTNGESQIFMAT
HLGYGLWFGEDEVNVVGARAAGVKGINLKEDDFVVSGEILQQSDSIVLFTQRGAVKRMSL
SEFEKTSRAKRGVVMLRELKKNPHRVVALFACGLEQRLMAETEKGDRKELQTKELRTNDR
YSNGSFFFDEEESGKVTAVWRLHTEQ
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacagccagaattatttcatgatttaccattagaagaggtgatcggcgaccgtttt
ggacgctacagtaaatatattattcaagacagggcgctgcccgatgcgagagacggatta
aagccggtacagcgcagaattctgtatgcaatgcatacagatggaaacacgtttgataaa
aacttcagaaaagcggccaaaacggtcggtaacgtcatcggtaactatcatccgcacggt
gacagctcggtttatgaagcaatggtgcggatgagccaggattggaaagttcgtaatgtg
ttaatcgaaatgcatggaaacaatggaagcatcgacggagatcccccggcagccatgcgt
tatacagaggcacgattatctccgatagcatctgagcttcttcgggatattgacaaaaac
acggttgaatttgtgccgaacttcgatgatacaagcaaggagcctgtcgtactcccggcg
atgtttcctaacctattggtcaacggatctaccgggatttcagcaggatacgcgaccgac
attccccctcatcatctgggagaagtcattgatgctgtcattaagcgtattcaaatgcct
tcttgctctgttgacgaactcatggaagttattaaagggcctgattttccgacaggcggt
attattcagggcgttgacgggataagaaaagcttacgaaaccggaaaaggaaaaatcatt
atccgcggaaaggctgaaattgaaacaatcagaggcggacgagaacaaattgtcattact
gaaattccatttgaagtaaataaagcaaaccttgtaaaaaaaatggacgagttccgtatt
gataaaaaggttgaaggcatctcagaggttcgtgatgaaacggatcgaacagggctgaga
gtggtcattgaactgaaaaaagaagctgatgccaaaggcattttgaatttcttatataaa
aatactgatttgcagatcacatataacttcaatatggtggctatccataaccgccgtccg
atgctgatgagcctgccgtctattttggatgcatatatcggacaccaaaaggaagttgtc
acaaaccggtccgtttacgagcttcaaaaagcaaaagacagacatcatatcgtagaaggg
ctcatgaaagctttgtctattttggatgaagtgattgcaacaatccgttcttctagcgat
aaacgtgacgctaaaaacaatttgatcgcgaaatatgaatttacagagcctcaggctgaa
gccatcgtgtcattgcagctatatcgtttaaccaataccgatatcacagcgcttaaggaa
gaggcagaagagctcggtaaaaaaattgaagagctcgaatctattctgagcaatgataaa
aaactgctaaaagtgattacaaacagcttaaaagcactgaaaaagaaatatgcagatacg
agacgctccgtgattgaagaaaaaattgaagaaattaaaatcaatctcgaagtcatggtt
gcatctgaggatgtatatgtaaccgttacgaaggatggttacctaaaacggacgagccag
cgctcatttgccgcttccaacggtcaggacttcggaatgaaagatacggacaggatgctg
catcagtttgaaatgaatacgacagacgtgctgctgctctttacgaacaaaggaagctac
atctattgtcctgttcaccagctgcctgatatcagatggaaggacatgggccagcatttt
tcaaatctaatcactattgaccgtgatgaaacgattgtaaaggctataccgataaaagaa
tttgatccgtcggcatatcttctattctttacgaaaaacggtatggtgaaaaagacagag
ctcactcattataaagcacagcgttattctaaggcacttgtagccttaaatctgaagggt
gaagatgaactgattgatgtacatgtaacaaatggggaaagccagatctttatggccact
cacttagggtatggtctatggtttggagaagacgaagtgaatgtagttggcgcgcgtgcg
gcaggtgtcaaagggattaacttaaaagaggatgactttgttgtctccggtgagattctt
cagcaatctgattcaattgtcttgttcacacagcggggagcggttaaacgcatgagtctt
tctgagttcgagaagacatcccgtgcaaaacgcggtgtcgtaatgctaagggaactgaaa
aagaatcctcaccgtgttgtagcactgttcgcttgcggtcttgaacagcgactaatggca
gaaacagaaaaaggcgacagaaaagaactgcagacaaaagagttgcggacaaacgacaga
tacagcaatggctctttcttttttgatgaagaggaatcaggcaaggttacagctgtttgg
cgccttcatacagaacaataa

DBGET integrated database retrieval system