KEGG   Bacillus subtilis subsp. subtilis 168: BSU18110Help
Entry
BSU18110          CDS       T00010                                 

Gene name
ynfC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 937092
NCBI-ProteinID: NP_389693
Pasteur: BG11828
BSORF: BG11828
UniProt: Q45067
Position
complement(1938066..1938476)
Genome map
AA seq 136 aa AA seqDB search
MDWGIIIKIFSNIKGGGDHLKKVTILKASILFLAIASFHLFSIPHAFDIGHHYKAVADQQ
EMHEMKAGQNADDEKKSITGAFTLTALWAMAVLLLTAESKSTGYSRRRQRKKSFILAKFY
QSSYFGKLHVQHHPIM
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggattggggtattattataaaaatattcagtaatattaaaggagggggagatcatttg
aaaaaagtaacgatattgaaagcatccatcttattcttggcgattgccagttttcatttg
ttctcaattccccacgcctttgatatcggccatcattataaagccgtagccgaccagcag
gaaatgcatgagatgaaagccggccaaaatgctgatgatgagaagaaatccatcacaggg
gcatttacgctgaccgctttatgggcaatggctgttctgctgctgaccgctgaaagcaaa
agtacgggatactcccgcagacgtcagcggaaaaaaagctttatactggccaaattttat
caatcgtcttatttcggcaaacttcatgttcaacatcacccgattatgtaa

DBGET integrated database retrieval system