KEGG   Bacillus subtilis subsp. subtilis 168: BSU18130Help
Entry
BSU18130          CDS       T00010                                 

Gene name
eglS
Definition
(RefSeq) endoglucanase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU18130 (eglS)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU18130 (eglS)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BSU18130 (eglS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase CBM_3 Glyco_hydro_cc baeRF_family2
Motif
Other DBs
NCBI-GeneID: 938607
NCBI-ProteinID: NP_389695
Pasteur: BG10437
BSORF: BG10437
UniProt: P10475
Structure
PDB: 

Position
1940625..1942124
Genome map
AA seq 499 aa AA seqDB search
MKRSISIFITCLLITLLTMGGMIASPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESS
SALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIPETPSKDKPTQENGISVQYRA
GDGSMNSNQIRPQLQIKNNGNTTVDLKDVTARYWYKAKNKGQNFDCDYAQIGCGNVTHKF
VTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKT
TKKITLYDQGKLIWGTEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatctctatttttattacgtgtttattgattacgttattgacaatgggc
ggcatgatagcttcgccggcatcagcagcagggacaaaaacgccagtagccaagaatggc
cagcttagcataaaaggtacacagctcgttaaccgagacggtaaagcggtacagctgaag
gggatcagttcacacggattgcaatggtatggagaatatgtcaataaagacagcttaaaa
tggctgagagatgattggggtatcaccgttttccgtgcagcgatgtatacggcagatggc
ggttatattgacaacccgtccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gagcttgggatatatgtcatcattgactggcatatcttaaatgacggtaatccaaaccaa
aataaagagaaggcaaaagaattcttcaaggaaatgtcaagcctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgatgtgaactggaagcgtgatatt
aaaccatatgcggaagaagtgatttcagttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgccgatgaccagctaaaa
gatgcaaacgttatgtacgcacttcatttttatgccggcacacacggccaatttttacgg
gataaagcaaactatgcactcagcaaaggagcacctatttttgtgacagagtggggaaca
agcgacgcgtctggcaatggcggtgtattccttgatcaatcgagggaatggctgaaatat
ctcgacagcaagaccattagctgggtgaactggaatctttctgataagcaggaatcatcc
tcagctttaaagccgggggcatctaaaacaggcggctggcggttgtcagatttatctgct
tcaggaacattcgttagagaaaacattctcggcaccaaagattcgacgaaggacattcct
gaaacgccatcaaaagataaacccacacaggaaaatggtatttctgtacagtacagagca
ggggatgggagtatgaacagcaaccaaatccgtccgcagcttcaaataaaaaataacggc
aataccacggttgatttaaaagatgtcactgcccgttactggtataaagcgaaaaacaaa
ggccaaaactttgactgtgactacgcgcagattggatgcggcaatgtgacacacaagttt
gtgacgttgcataaaccaaagcaaggtgcagatacctatctggaacttggatttaaaaac
ggaacgttggcaccgggagcaagcacagggaatattcagctccgtcttcacaatgatgac
tggagcaattatgcacaaagcggcgattattcctttttcaaatcaaatacgtttaaaaca
acgaaaaaaatcacattatatgatcaaggaaaactgatttggggaacagaaccaaattag

DBGET integrated database retrieval system