KEGG   Bacillus subtilis subsp. subtilis 168: BSU18140Help
Entry
BSU18140          CDS       T00010                                 

Gene name
ynfE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YnfE HSCB_C
Motif
Other DBs
NCBI-GeneID: 936469
NCBI-ProteinID: NP_389696
Pasteur: BG11829
BSORF: BG11829
UniProt: Q45069
Position
1942192..1942455
Genome map
AA seq 87 aa AA seqDB search
MDEILKQYMVLYKKMSNMINGPDYPGKEKDIQHQKDQIEVYEKQLQQGFSTDYDYDVFAD
SVIKCAYGDMTLEDLEAVYYGLTTPFF
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtggatgaaatactgaaacagtatatggtgctgtataaaaaaatgagtaatatgataaat
ggtcccgactatccaggtaaggaaaaagacatccagcatcaaaaagatcagatcgaagtt
tacgaaaaacagctgcagcaaggattttctacagattatgactatgatgtgtttgctgat
tctgttatcaaatgcgcatatggcgatatgacgctggaagatttagaagccgtttattat
ggattgacaacaccatttttttga

DBGET integrated database retrieval system