KEGG   Bacillus subtilis subsp. subtilis 168: BSU18150Help
Entry
BSU18150          CDS       T00010                                 

Gene name
xynC
Definition
(RefSeq) glucuronoxylanase XynC
  KO
K15924  glucuronoarabinoxylan endo-1,4-beta-xylanase [EC:3.2.1.136]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU18150 (xynC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.136  glucuronoarabinoxylan endo-1,4-beta-xylanase
     BSU18150 (xynC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30C Glyco_hydro_30 Glyco_hydr_30_2
Motif
Other DBs
NCBI-GeneID: 937052
NCBI-ProteinID: NP_389697
Pasteur: BG11830
BSORF: BG11830
UniProt: Q45070
Structure
PDB: 

Position
complement(1942714..1943982)
Genome map
AA seq 422 aa AA seqDB search
MIPRIKKTICVLLVCFTMLSVMLGPGATEVLAASDVTVNVSAEKQVIRGFGGMNHPAWAG
DLTAAQRETAFGNGQNQLGFSILRIHVDENRNNWYKEVETAKSAVKHGAIVFASPWNPPS
DMVETFNRNGDTSAKRLKYNKYAAYAQHLNDFVTFMKNNGVNLYAISVQNEPDYAHEWTW
WTPQEILRFMRENAGSINARVIAPESFQYLKNLSDPILNDPQALANMDILGTHLYGTQVS
QFPYPLFKQKGAGKDLWMTEVYYPNSDTNSADRWPEALDVSQHIHNAMVEGDFQAYVWWY
IRRSYGPMKEDGTISKRGYNMAHFSKFVRPGYVRIDATKNPNANVYVSAYKGDNKVVIVA
INKSNTGVNQNFVLQNGSASNVSRWITSSSSNLQPGTNLTVSGNHFWAHLPAQSVTTFVV
NR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgattccacgcataaaaaaaacaatttgtgtactattagtatgtttcactatgctgtca
gtcatgttagggccaggcgctactgaagttttggcagcaagtgatgtaacagttaatgta
tctgcagagaaacaagtgattcgcggttttggagggatgaatcatccggcttgggctggg
gatcttacagcagctcaaagagaaactgcttttggcaatggacagaaccagttaggattt
tcaatcttaagaattcatgtagatgaaaatcgaaataattggtataaagaggtggagact
gcaaagagtgcggtcaaacacggagcaatcgtttttgcttctccttggaatcctccaagt
gatatggttgagacctttaatcggaatggtgacacatcggctaaacggctgaaatacaac
aagtacgcagcatacgcgcagcatcttaacgattttgttaccttcatgaagaataatggt
gtgaatctttacgcgatttcggtccaaaacgagcctgattacgctcacgagtggacgtgg
tggacgccgcaagaaatacttcgctttatgagagaaaacgccggctcgatcaatgcccgc
gtcattgcgcctgagtcatttcaatacttgaagaatttgtcggacccgatcttgaacgat
ccgcaggctcttgccaatatggatattctcggaactcacctgtacggcacccaggtcagc
caattcccttatcctcttttcaaacaaaaaggagcggggaaggacctttggatgacggaa
gtatactatccaaacagtgataccaactcggcggatcgatggcctgaggcattggatgtt
tcacagcatattcacaatgcgatggtagagggggactttcaagcttatgtatggtggtac
atccgaagatcatatggacctatgaaagaagatggtacgatcagcaaacgcggctacaat
atggctcatttctcaaagtttgtgcgtcccggctatgtaaggattgatgcaacgaaaaac
cctaatgcgaacgtttacgtgtcagcctataaaggtgacaacaaggtcgttattgttgcc
atcaataaaagcaacacaggagtcaaccaaaactttgttttgcagaatggatctgcttca
aacgtatctagatggatcacgagcagcagcagcaatctacaacctggaacgaatctcact
gtatcaggcaatcatttttgggctcatcttccagctcaaagcgtgacaacatttgttgta
aatcgttaa

DBGET integrated database retrieval system