KEGG   Bacillus subtilis subsp. subtilis 168: BSU18160Help
Entry
BSU18160          CDS       T00010                                 

Gene name
xynD
Definition
(RefSeq) arabinoxylan arabinofuranohydrolase
  KO
K15921  arabinoxylan arabinofuranohydrolase [EC:3.2.1.55]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU18160 (xynD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     BSU18160 (xynD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_6 Glyco_hydro_43 DUF5010_C
Motif
Other DBs
NCBI-GeneID: 936433
NCBI-ProteinID: NP_389698
Pasteur: BG11807
BSORF: BG11807
UniProt: Q45071
Structure
PDB: 

Position
complement(1944113..1945654)
Genome map
AA seq 513 aa AA seqDB search
MRKKCSVCLWILVLLLSCLSGKSAYAATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRV
YIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIA
KWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPG
MSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGS
ASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGH
FLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADG
SIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDW
IAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETA
VSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaaagtgtagcgtatgtttatggattctagttttattattgagctgcttatct
gggaagtctgcgtatgctgccactagtactacaattgcaaaacatatagggaattcaaat
ccgcttatcgaccatcatttgggagcggatccggttgcgctgacctataacggaagagtc
tacatctatatgtcaagtgatgactatgaatataatagcaacggaacaattaaagataat
tcatttgccaatttgaatagagtattcgtcatatcttcagcggatatggtgaactggaca
gaccacggagccattccggtagcaggtgccaatggagctaatggaggccgtggaattgca
aaatgggcaggtgcgtcatgggcaccgtcaatcgcagttaaaaaaattaatggcaaggat
aaattcttcctttatttcgcaaacagcggcggaggtatcggggttctcaccgcagacagc
ccgattggtccatggaccgacccaatcggaaaaccgctcgtaacgccaagtacgccagga
atgtctggtgttgtatggctttttgatccggcagtatttgtagatgacgacggaaccggt
tacctgtatgccggcggaggcgttcctggcgtttcaaatccaacgcagggacaatgggcc
aatcctaaaacggctagagtcataaaattggggcctgatatgacgagtgttgttggaagt
gcatctacaattgatgcgcctttcatgtttgaagattcgggattgcacaagtataacgga
acatattattactcctattgcatcaatttcggcggcacgcacccggccgataaacccccg
ggtgagatcggctacatgaccagttcaagtcccatgggtccctttacatatagagggcac
ttcctgaaaaatccgggtgcatttttcggaggtggcggaaacaaccatcatgctgttttc
aattttaaaaacgagtggtatgtggtgtaccatgcgcaaactgtcagttccgctctgttc
ggggccggcaaaggataccgctctccccatattaataagctggtgcataatgcagatgga
tctattcaagaggtagcggcaaattatgcaggtgtaacacaaatttccaatttaaaccca
tataaccgggtagaagctgaaacgtttgcttggaatggacgcattttgacagagaagtcc
acagcacccggcgggccagtaaataatcagcatgtaacaagcattcaaaatggagactgg
attgctgtaggaaatgcagacttcggagcgggcggtgccaggtcatttaaagcaaatgta
gcatccactttaggcgggaaaatagaagtgcgcctcgacagtgcagacggtaagcttgtt
ggaactctgaatgtgccttcaacaggcggagcgcaaacgtggagggaaatagaaactgcg
gtaagcggggcaaccggtgtgcacaaagtattctttgtatttaccggaacaggtacagga
aacttgtttaattttgattactggcagtttacgcaaagatag

DBGET integrated database retrieval system