KEGG   Bacillus subtilis subsp. subtilis 168: BSU18170Help
Entry
BSU18170          CDS       T00010                                 

Gene name
yngA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GtrA TssN
Motif
Other DBs
NCBI-GeneID: 936300
NCBI-ProteinID: NP_389699
Pasteur: BG13452
BSORF: BG13452
UniProt: O31821
Position
1946249..1946695
Genome map
AA seq 148 aa AA seqDB search
MTATRIFYEGRFVTLKEKIKTLGRFCTVGVGNTLIDFGVFFLLTACHVSYLPAQICSYTA
GIVNSYVWNRNWTFCVKRKADGKEIVRFLMINIAASGITFLLLYLFQNCGCSLLVSKLAA
TIGGMMMNFIGNRIWVFGDSLKNIQDQE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgactgccactcgcatcttttatgaagggaggttcgttacgctgaaagaaaaaataaag
acattaggccgtttttgcaccgtaggcgtcggcaatacgctgatagattttggtgtcttc
tttcttcttaccgcttgtcatgtctcttatctgccggcgcagatctgctcctatactgca
ggtatcgtcaacagctatgtgtggaaccggaattggacgttttgtgtgaaacgtaaggct
gacgggaaagagatcgtgcgttttctcatgattaatattgccgcgtcagggatcaccttt
ttgctgctttatttgtttcaaaattgcggctgctcgcttttggtgagtaagctcgccgcc
actatcggcggaatgatgatgaattttatcggaaaccgaatctgggtatttggagattcg
ctgaaaaacatacaggatcaggagtga

DBGET integrated database retrieval system