KEGG   Bacillus subtilis subsp. subtilis 168: BSU18190Help
Entry
BSU18190          CDS       T00010                                 

Gene name
yngC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc
Motif
Other DBs
NCBI-GeneID: 939567
NCBI-ProteinID: NP_389701
Pasteur: BG13454
BSORF: BG13454
UniProt: O31823
Position
1947668..1948264
Genome map
AA seq 198 aa AA seqDB search
MGSLISEILTWLTNMGYAGIAIGLMIEIIPSEIVLAYGGYMVSEGTIGFIGAIIAGVIGG
TIAQIFIYWIGRYGGRPFLDKYGKYLLIKKHHIDMSENWFQKYGAGVVFSARFIPVVRHA
ISIPAGIARMPFLKFVVLTVLAIIPWSILFVYLGIQLGSQWDDVENIAGTYTTPIMILAV
VVIALYFVIKKRTAIFKR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagtttgataagcgaaattttaacatggctgacgaacatgggatatgcgggtatt
gcgattgggttaatgattgaaatcattccgagtgagattgtattagcttatggcggctat
atggtatcggagggcacgattggatttattggcgcaattattgcgggtgttatcgggggc
accattgcccagatctttatttactggatcggtcgctatggcggcaggccatttctggac
aaatacgggaagtatttattgattaaaaagcatcatatcgatatgtcggaaaactggttt
cagaaatacggcgccggagttgtcttctcggctcgttttataccggttgtcagacatgcc
atatccattccggcaggtattgccagaatgccttttctcaaatttgtggtactgactgtg
cttgctatcattccatggtctatcctgtttgtttatttaggcatacagctaggaagccag
tgggatgatgttgagaatatagcaggcacttatacaacaccgattatgatattggctgtt
gtcgtgatagccctttattttgtgattaagaaacgtacagccatatttaaacgatag

DBGET integrated database retrieval system