KEGG   Bacillus subtilis subsp. subtilis 168: BSU18200Help
Entry
BSU18200          CDS       T00010                                 

Gene name
yngD
Definition
(RefSeq) oligoribonuclease NrnB
  KO
K07097  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU18200 (yngD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHA1 DHH
Motif
Other DBs
NCBI-GeneID: 936020
NCBI-ProteinID: NP_389702
Pasteur: BG13455
BSORF: BG13455
UniProt: O31824
Position
complement(1948313..1949512)
Genome map
AA seq 399 aa AA seqDB search
MYHLYSHNDLDGVGCGIVAKLAFGKDVEIRYNSVNGLNAQVQYFLEKAKESNRQDALFIT
DLAVNEENEERLNEYVHAGGKVKLIDHHKTALHLNEHEWGFVQVEYDDGRLTSATSLLYG
YLIENGFMKPTNALDQFTELVRQYDTWEWERYDQKQAKRLNDLFFLLSIDEFEAKMIQRL
STHDEFFFDDFEEKLLDLEDEKIERYLRRKKREMVQTFVHEHCVGIVHAESYHSELGNRL
GKDNPHLDYIAILSMGSKRVSLRTIHDYIDVSEIAGRYGGGGHAKASGCSITDEVYELFV
AEAFRIDPVRPDAFRNIYNLKGSANGSLYENRAQMRFFLFPLDNEWNIQINGETQDETFA
AFEEAEWFIKRNYAASLVRDEVFVAFLAENLKLANQHRK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatttatattcacataacgacttggacggagtaggatgcggaatcgtagcaaaa
ttggcgttcggaaaagacgtagagatccggtataactctgtcaacggcttaaacgcacag
gtgcagtactttttagaaaaagcgaaggagagcaacagacaggacgcgttattcatcacc
gatctcgccgtcaatgaagaaaacgaagagagattgaatgagtatgttcatgcagggggc
aaagtgaagctcattgaccatcataaaacagcccttcatttgaatgagcatgaatgggga
tttgtccaggtggaatacgatgatggaaggctcacatccgcgacatcgcttttatatggc
tatctcattgaaaatggcttcatgaaaccgacaaacgccttagatcaattcacagagctc
gtccgccaatacgatacatgggagtgggagcggtacgatcaaaaacaggcgaagcggctt
aatgatcttttctttttgctgtcaatcgatgaatttgaagcaaaaatgatccagcgcctt
tccacgcatgacgaatttttcttcgatgattttgaagaaaaactgcttgatttagaagac
gaaaaaatcgagcgctacctccgcagaaagaaaagggaaatggtacaaacctttgttcac
gaacactgtgtaggcatcgttcacgctgaatcgtaccattcagagctggggaacaggcta
gggaaagataacccgcacctcgattacattgcgattttgagcatggggtcaaaacgagtc
agtctccgcaccattcatgattacatcgatgtgtcagaaatcgccggccgatatggcggc
ggagggcatgcaaaagcgtccggctgttcaataaccgatgaagtatacgagttgtttgta
gctgaagctttccgtattgatcctgtacggccggatgccttccgtaacatctataatcta
aagggatctgcgaatggatcattatatgaaaatcgcgcacaaatgagattttttcttttc
cctttagacaacgaatggaatattcaaattaacggagaaacccaagacgaaacattcgca
gcgtttgaagaggcagaatggtttattaagagaaattatgccgcatcgctcgtgcgggat
gaagtgtttgtcgcatttttagcggagaatctgaagctggcaaatcaacatcgcaagtaa

DBGET integrated database retrieval system