KEGG   Bacillus subtilis subsp. subtilis 168: BSU18210Help
Entry
BSU18210          CDS       T00010                                 

Gene name
yngE
Definition
(RefSeq) carboxylase YngE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans MdcE WTX
Motif
Other DBs
NCBI-GeneID: 939528
NCBI-ProteinID: NP_389703
Pasteur: BG13456
BSORF: BG13456
UniProt: O31825
Position
complement(1949682..1951217)
Genome map
AA seq 511 aa AA seqDB search
MLMDYEKERTERAERIRKGGAEKYHQSNREKGKLFVRERLSLLFDDDIELEDAFFAECMS
DGLPADGVVTAIGKIGGQTVCVMANDSTVKAGSWGAKTVEKIIRIQEIAEKLNCPLIYLV
DSAGARITDQINVFPGRRGAGRIFYNQVKLSGRIPQICLLFGPSAAGGAYIPAFCDIVVM
VDGNASMYLGSPRMAEMVIGEKVSLEEMGGARMHCSISGCGDILAETEEEAIQLVRAYLS
YFPANFQEKAPIHEKRPPKHFETPLADVIPQNQNAPFDMHELIERVIDEDSFFEIKALFA
PELLTGLARIHGQPVGIVANQPKVKGGVLFHDSADKAAKFITLCDAFHIPLLFLADIPGF
MIGTKVEQAGIIRHGAKMISAMSEATVPKLSVIVRKAYGAGLYAMAGPAFEPDCCLALPT
AQIAVMGPEAAVNAVYAKKIAELPEEERAAFISSKREEYKEDINIYRLASEMIIDAVIPA
NSLRDELAKRLKAYMTKEMTFTNRKHPVYPV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgctgatggattatgaaaaggaacgaacagaacgggctgaacggattcgaaaaggcgga
gcggaaaagtatcatcaaagcaatcgggaaaaaggcaagctctttgtcagagagcggctt
tcccttctctttgacgatgacattgagctagaagacgctttttttgcggaatgtatgtca
gacgggcttcccgctgacggagttgtaaccgctatcggcaaaatcggcggccaaaccgtt
tgcgtcatggcgaatgattcaacagtgaaagcggggtcatggggagcaaaaacagttgaa
aaaatcatcagaattcaagaaatcgccgaaaaattaaactgtccgctcatttatttagtc
gattcggcaggcgcccgaattaccgaccaaatcaatgtctttccagggagacgcggtgca
ggaagaattttttacaatcaagtcaaattatcgggacgcattccgcaaatctgtctgctt
ttcggaccatctgcggcaggaggcgcttatattccggccttctgtgatatcgtcgttatg
gtagacggtaacgcctccatgtatttaggttcgccaaggatggcggaaatggttattgga
gaaaaagtgtctctcgaagaaatgggtggcgcccgtatgcattgctcaatctccggctgc
ggagatattcttgcagaaactgaagaagaagccatacagctggtgcgggcttatttgtct
tactttccggcaaattttcaagaaaaagcgcccattcatgagaaacgcccgccaaaacac
ttcgaaactccgcttgccgacgtcattccgcaaaatcaaaacgcaccttttgatatgcat
gagctcattgagcgggtcatagatgaagactcattttttgagatcaaagccttatttgca
ccggaattattgacgggcctcgcacgaatccacggacagcctgtcggcattgttgcaaac
cagccgaaggtaaaaggaggcgtcttattccacgattcagcagacaaagcggctaagttt
attaccttatgtgacgcttttcatatcccattgctgttcttagccgatatccccggtttt
atgattggcacaaaagtagaacaggctgggattatcagacacggagcgaaaatgatttct
gcgatgtcggaggcaactgttccaaaactctctgtcattgtccgaaaagcttacggggcg
gggttgtatgcaatggcagggccggcatttgaaccggattgctgtctagcgctcccaacc
gcccaaatcgccgtcatgggccctgaggccgctgtaaacgctgtctacgctaaaaaaatc
gccgagctgccagaagaagagagagccgcatttatcagcagcaaacgggaggaatacaaa
gaggacatcaatatctaccgtctggcttcagaaatgatcattgatgctgttatcccagcc
aattcgctgcgtgatgagctggccaaacggctcaaggcatacatgacaaaggaaatgaca
tttaccaatcgaaagcatccggtttatccggtgtaa

DBGET integrated database retrieval system