KEGG   Bacillus subtilis subsp. subtilis 168: BSU18220Help
Entry
BSU18220          CDS       T00010                                 

Gene name
yngF
Definition
(RefSeq) enoyl-CoA hydratase/isomerase YngF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 939467
NCBI-ProteinID: NP_389704
Pasteur: BG13457
BSORF: BG13457
UniProt: O34893
Position
complement(1951228..1952010)
Genome map
AA seq 260 aa AA seqDB search
MGDSILFTVKNEHMALITLNRPQAANALSAEMLRNLQMIIQEIEFNSNIRCVILTGTGEK
AFCAGADLKERIKLKEDQVLESVSLIQRTAALLDALPQPVIAAINGSALGGGLELALACD
LRIATEAAVLGLPETGLAIIPGAGGTQRLPRLIGRGKAKEFIYTGRRVTAHEAKEIGLVE
HVTAPCDLMPKAEELAAAISANGPIAVRQAKFAINKGLETDLATGLAIEQKAYEQTIPTK
DRREGLQAFQEKRRAVYKGI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggagattctattctttttactgttaaaaatgaacatatggcgttgatcaccttaaac
aggcctcaggcagcaaatgctctttcagcggaaatgcttagaaacctgcaaatgattatc
caggaaattgaatttaactcaaacatccgttgcgtcatcctcacaggcaccggtgaaaaa
gcgttttgtgcaggggcagacctgaaggaacggataaaactgaaagaagatcaggttctg
gaaagtgtatctctcattcaaagaacggcggctttacttgatgccttgccgcagccggtc
atagctgcgataaatggaagcgcattaggcggcggactagaattggcattggcatgcgac
cttcgaatcgcaactgaagcagctgtgctgggacttccggaaacagggttagctattatc
ccgggcgctggagggacccaaaggctgccccggctgattggcagaggaaaagcaaaagaa
ttcatttatacaggcagacgcgtgaccgcacacgaagcaaaagaaatcggccttgtagag
catgtcacggctccttgtgaccttatgccaaaagcagaggaactggccgcagccatttct
gccaacggaccgatcgctgtccgtcaggctaaatttgcaatcaataaaggattggagaca
gatcttgctacaggccttgcgattgaacaaaaagcgtatgaacaaaccatcccgacaaaa
gacaggagagaagggcttcaggcctttcaagaaaaaagacgggccgtatacaagggaata
taa

DBGET integrated database retrieval system