KEGG   Bacillus subtilis subsp. subtilis 168: BSU18230Help
Entry
BSU18230          CDS       T00010                                 

Gene name
yngG
Definition
(RefSeq) hydroxymethylglutaryl-CoA lyase YngG
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00072  Synthesis and degradation of ketone bodies
bsu00280  Valine, leucine and isoleucine degradation
bsu00281  Geraniol degradation
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU18230 (yngG)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BSU18230 (yngG)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU18230 (yngG)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BSU18230 (yngG)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     BSU18230 (yngG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DUF5070
Motif
Other DBs
NCBI-GeneID: 939515
NCBI-ProteinID: NP_389705
Pasteur: BG13458
BSORF: BG13458
UniProt: O34873
Structure
PDB: 

Position
complement(1952031..1952930)
Genome map
AA seq 299 aa AA seqDB search
MPYPKKVTIKEVGPRDGLQNEPVWIATEDKITWINQLSRTGLSYIEITSFVHPKWIPALR
DAIDVAKGIDREKGVTYAALVPNQRGLENALEGGINEACVFMSASETHNRKNINKSTSES
LHILKQVNNDAQKANLTTRAYLSTVFGCPYEKDVPIEQVIRLSEALFEFGISELSLGDTI
GAANPAQVETVLEALLARFPANQIALHFHDTRGTALANMVTALQMGITVFDGSAGGLGGC
PYAPGSSGNAATEDIVYMLEQMDIKTNVKLEKLLSAAKWIEEKMGKPLPSRNLQVFKSS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccatatcctaaaaaagtgacaatcaaagaagtcggcccgcgtgatggcttacaaaac
gagcccgtttggatcgcaacagaggataaaataacctggatcaaccagctttcccggaca
gggctgtcgtatattgaaatcacatccttcgttcacccgaaatggattccggcgcttcga
gatgctatcgatgtagcaaaaggcatcgaccgagaaaaaggggtaacgtacgcggcactt
gtcccgaatcaaagaggactggagaatgcacttgaaggaggcattaacgaggcttgcgtt
tttatgtccgccagcgagacgcacaacagaaaaaacatcaataaatccacttctgaatcc
ctccatatactcaaacaagtaaacaacgacgcacaaaaagcaaacctcacaacaagagcc
tacctctcgactgttttcggctgtccgtacgaaaaagatgtccccattgaacaagtcatt
cgcctttcagaagctctatttgaatttgggatttctgaactgtcgcttggagatacgatt
ggagcagctaatcccgcccaagtggaaactgtacttgaagctcttttggcacgattcccg
gctaatcaaattgccctgcattttcatgatacgagaggaaccgctctggccaacatggtc
acagcactccaaatgggcatcacggtgttcgacggctcggcaggcgggcttgggggatgc
ccatatgcgccaggttcatcaggaaacgccgcaactgaggatatcgtgtacatgcttgaa
cagatggatatcaaaacaaatgtaaagctagaaaaactgctatctgcggccaaatggatt
gaagaaaaaatgggcaaaccgctgccgagcagaaatttacaggtgtttaaatcatcttga

DBGET integrated database retrieval system