KEGG   Bacillus subtilis subsp. subtilis 168: BSU18240
Entry
BSU18240          CDS       T00010                                 

Gene name
yngH
Definition
(RefSeq) biotin carboxylase 2
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00620  Pyruvate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01212  Fatty acid metabolism
Module
bsu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU18240 (yngH)
   00640 Propanoate metabolism
    BSU18240 (yngH)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU18240 (yngH)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BSU18240 (yngH)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BSU18240 (yngH)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ATP-grasp_5 ATP-grasp_4
Other DBs
NCBI-GeneID: 939474
NCBI-ProteinID: NP_389706
Pasteur: BG13459
BSORF: BG13459
UniProt: O34544
Position
complement(1953181..1954515)
AA seq 444 aa
MFTKVLIANRGEIAMRIIRTCSRLGIKTVAVYSEADKDAPHTKAATEAYLIGESRVSESY
LNIERIIKTAKKAKADAIHPGYGLLSENSRFAERCKQENIVFIGPSPDIIAKMGSKIEAR
KAMEAAGVPVVPGVSESLGDIEAACRTASQIGYPVMLKASAGGGGIGMQRVENEEALKKA
YEGNKKRAADFFGDGSMYIEKVIEHARHIEVQLLADQHGHTVHLFERDCSVQRRHQKVIE
EAPSPFVDDELRMKIGQTAVKAAKAIGYTNAGTIEFIVDQKQNFYFLEMNTRLQVEHPVT
EEITGLDLVEQQLRIAAGHTLTFSQKDIQRNGHAIEVRIYAEDPKTFFPSPGTITAFSLP
DQKGVRHECAVAKDSTVTPFYDPMIAKMIVKGQTRTEAIEKLETALRDYRVEGIKTNLPL
LIQAAATKAFKEGDVTTDFLKQHL
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtttacaaaagtactgatcgccaaccgcggtgaaattgcaatgagaattatccgaaca
tgcagccgtctcggcattaaaacggtcgctgtttattcagaagcagacaaggacgcgccc
catacaaaagccgctacagaggcatatttgatcggggaatcgagagtcagtgaaagttat
ttaaatatagagagaatcataaagacggcgaaaaaagcaaaagccgacgcgatccacccg
ggatatggattgttatcagaaaacagccggttcgctgaacgctgcaagcaagaaaacatc
gtgtttatcggaccttcccctgatatcatcgcaaagatgggcagcaaaattgaagcgcga
aaagcaatggaggctgcaggtgtccctgtggtgccgggcgtttctgaatccctcggagat
atagaggcagcctgccgcaccgcaagtcaaatcggctatcctgtcatgctgaaagcttca
gcgggcggaggcggcatcggaatgcagcgtgttgaaaatgaagaagcattaaaaaaagcg
tacgagggaaacaaaaagcgcgcagcagattttttcggtgacgggtctatgtatatagaa
aaagttattgaacatgcgcgccacatcgaggttcagcttttggccgatcaacacggccat
acagtacatctgtttgaacgtgattgctctgttcagaggcgccaccaaaaagtcattgaa
gaagcaccgtctccatttgtagacgatgaactaagaatgaagatcggtcaaacagcggta
aaagcagcgaaggcaatcggctatacgaacgcaggcaccatcgaatttatagttgaccag
aaacaaaatttttatttcctcgaaatgaatacgagactgcaagttgaacaccccgtgact
gaagaaataacaggcctggacttagttgagcagcagctgcggattgctgcgggccataca
ctcacattctcccaaaaagacatccaacggaacgggcatgcgatagaggttcgaatatac
gcggaagatcccaagaccttcttcccgtcaccaggtacgatcactgcgttttcacttcct
gaccaaaaaggagtcagacacgaatgtgcggtagcaaaagacagcaccgttacccctttt
tatgacccgatgatcgctaagatgattgtcaaaggccaaaccagaacagaagcaattgaa
aaactagagacagcgcttcgcgactatcgtgtagagggaatcaaaacaaaccttccgctc
ctcatacaggctgcggcaacaaaggcatttaaagaaggggatgtcacgactgactttttg
aaacagcacctataa

DBGET integrated database retrieval system