KEGG   Bacillus subtilis subsp. subtilis 168: BSU18250Help
Entry
BSU18250          CDS       T00010                                 

Gene name
yngI
Definition
(RefSeq) acyl-CoA synthetase YngI
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU18250 (yngI)
Enzymes [BR:bsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     BSU18250 (yngI)
Lipid biosynthesis proteins [BR:bsu01004]
 Acyl-CoA synthetase
  Unknown
   BSU18250 (yngI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 939571
NCBI-ProteinID: NP_389707
Pasteur: BG13460
BSORF: BG13460
UniProt: O31826
Position
complement(1954525..1956174)
Genome map
AA seq 549 aa AA seqDB search
MAELIHSTIGRLLEQTADAYPDRDAVVYPDRNIRYTYAQFDSLCRQTAKGLMRMGIGKGD
HVAIWASNISEWLAVQFATAKIGAVLVTVNTNYQAHELDYLLKQSDAAALIIMDSYRGTS
YPDIVNSLIPELQEAKPGQLKSERYPFLKTLIYIGNKRLSGMYHWDDTEILAKTVTDAEL
EERMNSLDKDNVINMQYTSGTTGFPKGVMLTHFNVINNAANIAECMALTSQDRMCIPVPF
FHCFGCVLGVLACVSVGAAMIPVQEFDPVTVLKTVEKEKCTVLHGVPTMFIAELHHPDFD
AYDLSTLRTGIMAGSPCPSEVMKAVIERMGMKDITIAYGQTEASPVITQTRANDSFIRRV
ETTGRALPHTEVKIVEPGTCQEVQRGMQGELCTRGYHVMKGYYKDKDATRKAINHDGWLF
TGDLAVMDEDGYCRITGRLKDMLIRGGENIYPREIEEFLYQHPAVLDVQVVGVPDAKFGE
EAAAWIKLKDGKSVSPDELKAYCKGKIARHKIPRYVIFTDDYPMTASGKIQKYKLREKTI
EMFNLSSSQ
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactcatccattccacaatcggcaggctgctggaacaaacagctgatgcgtat
cccgatcgagatgctgttgtgtatccagaccgaaatatccgctatacgtacgctcaattt
gacagtctgtgccgtcaaaccgctaaaggtctcatgcggatggggattggaaaaggagac
cacgtcgccatatgggcttctaatatctctgaatggcttgccgtccagttcgcaactgcg
aagatcggagccgtgctcgtgaccgtcaataccaattatcaagcacatgagcttgattac
ttgttaaagcaatcggatgccgcggcgcttattatcatggattcatacaggggcacttct
tatccagacatcgtgaacagtttaattccagaactgcaagaagcaaagcccggccaactg
aaatctgaacgctatccctttttaaaaacgctgatctatattggcaataaacgattgtct
ggcatgtatcattgggacgatacagagatattggcgaaaacagtgacagatgctgagctt
gaagagagaatgaacagcctggataaagacaatgtgattaatatgcaatacacatcagga
acgacagggtttccaaaaggcgtgatgctgacccatttcaatgtcatcaataacgctgct
aatatcgctgaatgtatggctttaacctctcaagaccgcatgtgcatccctgttccgttt
tttcactgctttggatgcgtccttggggttttggcatgtgtatccgtcggggcagccatg
atacccgtgcaagaatttgatcccgttaccgtccttaaaacggtagaaaaagagaaatgc
acagtgctccatggtgtgcctaccatgtttatcgccgagctgcatcatccggattttgat
gcatatgatctatcgacgctccgaacaggaatcatggccggctctccctgtccaagtgaa
gtgatgaaagctgtgattgaaaggatgggcatgaaagacattacgatcgcctatggacaa
accgaagcctcgccagtcattacacaaacgagagcaaatgattccttcataagaagagtc
gaaacaaccggccgtgccctgccacatactgaggtgaaaattgtagaacccgggacatgt
caagaagttcaaagaggcatgcagggagaactgtgcacccgtggctatcacgtcatgaaa
ggctattataaagacaaagatgcgaccagaaaagcaatcaatcatgacggatggctgttt
accggagatcttgctgtcatggatgaagacgggtactgccgcatcaccggaagattaaaa
gatatgctcatcagaggcggcgagaacatttatccgcgggaaattgaagaatttttatac
cagcatcccgctgttttagatgtacaggtggttggtgtgcctgacgccaaattcggggag
gaagctgcagcctggattaaactgaaagacggtaaaagcgtttcacctgatgagcttaaa
gcctattgcaaagggaaaatcgcccgccacaaaattccgcgttatgttatttttacggat
gactatccgatgacggcctcaggcaaaattcaaaaatataaactgcgagaaaaaacgatt
gaaatgttcaacttatcatcaagtcaatga

DBGET integrated database retrieval system