KEGG   Bacillus subtilis subsp. subtilis 168: BSU18260Help
Entry
BSU18260          CDS       T00010                                 

Gene name
yngJ
Definition
(RefSeq) acyl-CoA dehydrogenase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M HpaB_N
Motif
Other DBs
NCBI-GeneID: 939996
NCBI-ProteinID: NP_389708
Pasteur: BG13461
BSORF: BG13461
UniProt: O34421
Position
complement(1956218..1957360)
Genome map
AA seq 380 aa AA seqDB search
MNFELTKEQQMVREMVKDFAKKEIAPHAEHVDQTGEFPMQTFKKMGELGLMGIPFPEEYG
GSGGDTISYALAVEEVGKACGSTGLSYAAAVSLGASPLYYFGTEEQKQTHLTPLASGTAL
GSFGLTEPNAGSDAGGTQTKAISNGDEYVINGEKCWITNASYARTVIVTAVTGKNKDGKN
IISALIVPTDTPGLTITSPYDKMGVRGSNTAEILLEDVRVPAANLLGDPTKGFKQFLYTL
DGGRISIAALAVGIAQAALDASLAYAKERKQFGQPISSFQAIQFKLADMAMEIDLARQMV
LKAAWLKDHNRPFTKEAAYAKLFASEMATRACNQAIQIHGGSGYMKEYGVERMLRDAKLM
EIGEGTSEIQRLVIARQLLK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgaattttgagctgacaaaagaacaacaaatggtgcgtgaaatggtaaaagattttgcg
aaaaaagaaattgctcctcacgctgaacatgtagatcaaacaggcgagttcccgatgcaa
acatttaaaaaaatgggtgaactcggtctgatgggtattccatttccagaagaatacggc
ggatctggcggtgatacgatttcatatgccttagcggttgaagaagtcggcaaagcctgc
ggcagtactggattaagctatgctgcagcggtctcgctaggcgcaagccctctttactac
ttcggaacagaagagcaaaaacagacgcatttgacgccgctggcttcaggcacagcactc
ggatcattcggcctgacggagccaaatgccggctcagatgcaggaggcactcaaacaaaa
gcgatttcaaatggtgacgagtatgtaatcaacggcgaaaagtgctggatcactaatgca
agctacgcacgcacagttattgtaaccgccgtaacaggcaaaaacaaagacggaaaaaac
atcatctccgcattaatcgtgccaactgacacaccaggacttacgattacgagcccgtac
gataaaatgggcgtccgcggttcgaatacagcggaaatcttgcttgaagatgtaagagtg
cctgcggccaacttacttggcgatccaacaaaagggtttaaacagtttctatatacgctg
gatggtggtcgaatctccatcgctgctcttgcagtcggcattgcccaagcggcccttgac
gcatcattggcatatgcgaaagagcgaaagcagtttggacagccgatttcttcctttcaa
gcgattcaatttaagcttgctgacatggcgatggaaattgatctggcacggcaaatggtg
ttaaaagccgcctggctgaaagatcataaccgcccgttcaccaaagaagcggcgtacgcc
aagctattcgcatctgaaatggcgacaagagcttgcaatcaagccattcaaatccatgga
ggttcaggctatatgaaagagtatggggtggaacggatgctgcgggacgcaaaattaatg
gaaatcggtgaaggcacatctgaaattcagcgtctcgtgatcgccagacagcttttaaaa
taa

DBGET integrated database retrieval system