KEGG   Bacillus subtilis subsp. subtilis 168: BSU18270Help
Entry
BSU18270          CDS       T00010                                 

Gene name
ynzE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5367 PrgI
Motif
Other DBs
NCBI-GeneID: 939980
NCBI-ProteinID: NP_389709
Pasteur: BG13468
BSORF: BG13468
UniProt: O34356
Position
complement(1957451..1957756)
Genome map
AA seq 101 aa AA seqDB search
MLTDPAEEAFLPNFLLLGAGTALVLCLVFFLYQKLDQSQFAVIKLGIWGSAVGLLMDTIS
LWNLPLIFPALSKGQVIAFTIWMVCAYCMYLLIPLILSHKK
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtgttgactgatccggctgaagaagcctttttgccgaactttcttctcttgggagcgggc
actgctcttgttttatgccttgtgttctttctctatcaaaaactcgatcaatcacagttc
gcggtgatcaagctaggtatatggggatcagcggtcggtttattgatggatacgatttcc
ctttggaatcttcccctcatcttcccggctttatcaaagggccaagttattgcgtttacg
atatggatggtatgcgcctactgcatgtatttgctcatcccgctgatattatcacataaa
aaatga

DBGET integrated database retrieval system