KEGG   Bacillus subtilis subsp. subtilis 168: BSU18280Help
Entry
BSU18280          CDS       T00010                                 

Gene name
yngK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHL10 Melibiase GHL6 DUF512
Motif
Other DBs
NCBI-GeneID: 939977
NCBI-ProteinID: NP_389710
Pasteur: BG13462
BSORF: BG13462
UniProt: O35015
Position
complement(1958027..1959559)
Genome map
AA seq 510 aa AA seqDB search
MKVCQKSIVRFLVSLIIGTFVISVPFMANAQSDRELRAVWIASVLNIDWPSKKGLSVKEQ
KQEYIKLLDDVQKMGMNAVIVQIKPTADAFYPSAYGPWSEYLTGVQGKDPGYDPLAFMIE
ETHKRNLEFHAWFNPYRITMNHTDLNKLSEDHPARKHPDWVAAYGNQLYYHPGIPEARDF
IVKGIEEVVKHYDIDAVHMDDYFYPYKIAGQEFPDQAQYEQYGKDAFSNIDDWRRDNVNQ
LVKQINQTIKAAKPYVKFGISPFGVWRNAADDPTGSNTKAGVRNYDDLYADTRHWIQEGD
IDYIAPQIYWSIGFNAAAYDVLADWWSNEVKNRPVHLYIGQAAYKINNNFDPPWSDPEEY
VRQITLNRQLELVKGSMHFSLKDLNKNPLGIKDSLSTDLYSKPALVPQMPWLDNTAPKKP
KLTKVTEDKNGNLLQIKDHPSNQKTKETAYYAIYRAEGKKQRTLLATQRKTHEQQTFLDN
TADPNKKYTYYVTSADRLHNESKASKRTTK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttgccaaaagtcgattgtccgtttccttgtcagcttgatcatcggaacgttt
gtcatttccgttccgtttatggccaatgcgcagtctgacagggagctgagagccgtatgg
attgcttccgtattaaatattgattggccgtccaaaaaagggttatctgtgaaagagcaa
aaacaggagtatatcaaactgctggacgatgtgcaaaaaatgggaatgaatgccgttatc
gttcagattaaaccgacggctgatgccttttatccgtcagcttacgggccttggtcggaa
tacttaaccggtgtccaagggaaggaccccggctatgatcctcttgcatttatgattgaa
gaaacccataaacgaaatttggaatttcacgcgtggtttaatccttaccgtattacaatg
aatcatacagatcttaataaattgtctgaggatcacccggcaagaaaacatccagattgg
gttgccgcctatggaaaccagctgtattatcatccaggcattccagaagcgagagatttt
atcgtcaaaggcattgaagaagtcgtaaaacattatgatatcgatgctgttcatatggat
gattatttttacccttataaaatagcgggacaggaatttcctgatcaagcacagtacgaa
caatacggaaaagacgctttttctaatatcgatgactggcggcgggacaatgtgaaccag
cttgtcaaacaaatcaaccaaacaattaaagctgcaaaaccgtatgtcaaattcggcatc
agtccctttggagtatggagaaacgccgcagatgacccgaccggatcgaatacaaaagca
ggcgtcagaaattatgacgatctatatgcagacacaaggcattggatccaagaaggcgac
atcgattatattgctccgcaaatttattggagtatcggctttaacgcagcggcttacgac
gtgctggctgattggtggagcaatgaagtcaaaaataggcctgttcacttatatattggc
caggcagcatataaaatcaataacaattttgatccgccttggtccgatcctgaggaatat
gtgcggcaaatcactttgaaccgccagcttgaactggtgaaaggaagcatgcatttcagc
ctcaaggacctcaacaaaaatccgcttggcatcaaagacagtctcagcaccgatctttac
agcaagccggcactggttccgcaaatgccttggcttgacaataccgccccaaaaaaaccg
aagcttacgaaagtcaccgaagacaaaaacggcaatcttctgcagattaaagatcaccca
tcaaatcaaaaaacgaaagaaacagcctattatgcgatatacagagccgaagggaaaaag
cagagaacattgctggcaacgcaaagaaaaacacatgagcagcaaaccttcttagataac
acggcagatcccaacaagaaatatacgtattatgtcacttcagcagaccggcttcataac
gaaagcaaagcttccaaacgaacaacaaaataa

DBGET integrated database retrieval system