KEGG   Bacillus subtilis subsp. subtilis 168: BSU18280
Entry
BSU18280          CDS       T00010                                 

Symbol
yngK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GHL10 Melibiase GHL6 DUF512
Other DBs
NCBI-GeneID: 939977
NCBI-ProteinID: NP_389710
Pasteur: BG13462
BSORF: BG13462
UniProt: O35015 A0A6M4JIQ1
Position
complement(1958027..1959559)
AA seq 510 aa
MKVCQKSIVRFLVSLIIGTFVISVPFMANAQSDRELRAVWIASVLNIDWPSKKGLSVKEQ
KQEYIKLLDDVQKMGMNAVIVQIKPTADAFYPSAYGPWSEYLTGVQGKDPGYDPLAFMIE
ETHKRNLEFHAWFNPYRITMNHTDLNKLSEDHPARKHPDWVAAYGNQLYYHPGIPEARDF
IVKGIEEVVKHYDIDAVHMDDYFYPYKIAGQEFPDQAQYEQYGKDAFSNIDDWRRDNVNQ
LVKQINQTIKAAKPYVKFGISPFGVWRNAADDPTGSNTKAGVRNYDDLYADTRHWIQEGD
IDYIAPQIYWSIGFNAAAYDVLADWWSNEVKNRPVHLYIGQAAYKINNNFDPPWSDPEEY
VRQITLNRQLELVKGSMHFSLKDLNKNPLGIKDSLSTDLYSKPALVPQMPWLDNTAPKKP
KLTKVTEDKNGNLLQIKDHPSNQKTKETAYYAIYRAEGKKQRTLLATQRKTHEQQTFLDN
TADPNKKYTYYVTSADRLHNESKASKRTTK
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgaaggtttgccaaaagtcgattgtccgtttccttgtcagcttgatcatcggaacgttt
gtcatttccgttccgtttatggccaatgcgcagtctgacagggagctgagagccgtatgg
attgcttccgtattaaatattgattggccgtccaaaaaagggttatctgtgaaagagcaa
aaacaggagtatatcaaactgctggacgatgtgcaaaaaatgggaatgaatgccgttatc
gttcagattaaaccgacggctgatgccttttatccgtcagcttacgggccttggtcggaa
tacttaaccggtgtccaagggaaggaccccggctatgatcctcttgcatttatgattgaa
gaaacccataaacgaaatttggaatttcacgcgtggtttaatccttaccgtattacaatg
aatcatacagatcttaataaattgtctgaggatcacccggcaagaaaacatccagattgg
gttgccgcctatggaaaccagctgtattatcatccaggcattccagaagcgagagatttt
atcgtcaaaggcattgaagaagtcgtaaaacattatgatatcgatgctgttcatatggat
gattatttttacccttataaaatagcgggacaggaatttcctgatcaagcacagtacgaa
caatacggaaaagacgctttttctaatatcgatgactggcggcgggacaatgtgaaccag
cttgtcaaacaaatcaaccaaacaattaaagctgcaaaaccgtatgtcaaattcggcatc
agtccctttggagtatggagaaacgccgcagatgacccgaccggatcgaatacaaaagca
ggcgtcagaaattatgacgatctatatgcagacacaaggcattggatccaagaaggcgac
atcgattatattgctccgcaaatttattggagtatcggctttaacgcagcggcttacgac
gtgctggctgattggtggagcaatgaagtcaaaaataggcctgttcacttatatattggc
caggcagcatataaaatcaataacaattttgatccgccttggtccgatcctgaggaatat
gtgcggcaaatcactttgaaccgccagcttgaactggtgaaaggaagcatgcatttcagc
ctcaaggacctcaacaaaaatccgcttggcatcaaagacagtctcagcaccgatctttac
agcaagccggcactggttccgcaaatgccttggcttgacaataccgccccaaaaaaaccg
aagcttacgaaagtcaccgaagacaaaaacggcaatcttctgcagattaaagatcaccca
tcaaatcaaaaaacgaaagaaacagcctattatgcgatatacagagccgaagggaaaaag
cagagaacattgctggcaacgcaaagaaaaacacatgagcagcaaaccttcttagataac
acggcagatcccaacaagaaatatacgtattatgtcacttcagcagaccggcttcataac
gaaagcaaagcttccaaacgaacaacaaaataa

DBGET integrated database retrieval system