KEGG   Bacillus subtilis subsp. subtilis 168: BSU18290Help
Entry
BSU18290          CDS       T00010                                 

Gene name
yngL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1360
Motif
Other DBs
NCBI-GeneID: 939955
NCBI-ProteinID: NP_389711
Pasteur: BG13463
BSORF: BG13463
UniProt: O34506
Position
complement(1959695..1960087)
Genome map
AA seq 130 aa AA seqDB search
MDRLSFLTFIMLILASYRLTHLIVFDKITEFIRKPFMKKKRIVDQNGHVDEKSVPASNFG
YMLNCYWCAGVWCAILIGLGYLFLPRIAIPLIFILAIAGAQAILETAVGVGVKLIDVLKS
LQTMMNDKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtctttcttttctaacttttatcatgctgattctagccagttacaggctgaca
catttgattgtatttgacaaaatcacagaatttatccgaaaaccttttatgaaaaagaaa
aggattgttgatcaaaacgggcatgtagatgaaaaaagcgtgccggcttctaactttgga
tacatgctcaattgctactggtgtgccggtgtttggtgtgccatcttgatcggacttggc
tatctttttttgcctcgtattgcaataccgctgatctttattttagccattgccggagca
caagcgatccttgaaacggctgtcggtgtcggcgtaaaacttattgatgtgttaaaaagt
ctgcaaaccatgatgaatgataaaaagtcctaa

DBGET integrated database retrieval system