KEGG   Bacillus subtilis subsp. subtilis 168: BSU18300Help
Entry
BSU18300          CDS       T00010                                 

Gene name
ppsE
Definition
(RefSeq) plipastatin synthase subunit E
  KO
K15668  fengycin family lipopeptide synthetase E
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BSU18300 (ppsE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU18300 (ppsE)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    BSU18300 (ppsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding Thioesterase PP-binding AMP-binding_C Abhydrolase_3 TetR_C_24 DUF2974
Motif
Other DBs
NCBI-GeneID: 939956
NCBI-ProteinID: NP_389712
Pasteur: BG11962
BSORF: BG11962
UniProt: O31827
Position
complement(1960198..1964037)
Genome map
AA seq 1279 aa AA seqDB search
MKKGADTMNTIKKIKNIYPLSHMQEGMLFHSFLRKEEGAYVEQSLFTIKGSLSYDWFQRS
IQAIIDRHDIFRTVFLPHVPHLSGPRQVVMTEREFHLNSEDISHLPTNDQNEYIERFKEK
DKQKGFDLQKDMLMRISLFKTAKDEHVCIWSHHHILMDGWCLGIVMQEFMQIYQSIHAGK
PLSLDPVRPYSTYISWLTNRDKEKAAAYWDTYLKNYSAPSPLPRVSDKETKESYHREDLI
FSLNKPLTDKLKETAKQHGVTLATLIQAVWGVMLQQYNRTDDVVFGAVVSGRPSEIPGVE
QMIGLFINTIPIRIKTHQDETFHELLIRCQKEMLEAEPFTCQPLFDIQANTALKQELIDH
IIVFENYPLQQKIADSADQTDSPLQIDQVQVSEQSGYNFNLVVAPGEELVIKFSYNAFVY
DAAWISCIKRQFTQALSTAAQHPHMPIADFSFLDATEKEQIVTQFNNTKTEYPKNHTIID
LFREQAEKTPDHTALVYGNMSISYKELDKRSNALARELIQKGFRKNETAGILAAHSPEFM
ISVLAVLKAGGAYLPLDAELPPERVSFMLEETQAKMLIVQKGLEQNAAFSGTCIISDAQG
LMEENDIPINISSSPDDLAYIMYTSGSTGRPKGVMITNRNVVSLVRNSNYTSASGDDRFI
MTGSISFDAVTFEMFGALLNGASLHIIDKSTMLTPDRFGAYLLENDITVLFLTTALFNQL
AQVRADMFRGLHTLYVGGEALSPALMNAVRHACPDLALHNIYGPTENTTFSTFFEMKRDY
AGPIPIGKPISNSTAYILDTKGRLLPIGVPGELCVGGDGVAKGYLNRVDLTNAVFSPHPF
LPGERIYRTGDLARWLPDGNLEYISRIDRQMKIRGKRIEPAEIEARLLEMEGVQEAAVTL
REKDGEAQLYTHYVGDHKKTDTDFRADLARVLPDYMIPQHWVRVERMPLTGNGKIDRSAL
PIPENKPAKRQNIILPRNLVEEELANIWKQVLGVNTISIDDDFFAIGGHSLRALQVIHTL
KHQQNIDIPIDFLFEHPTIAQLAEKLYSKQLTAANEQHVIKLNQHGAQNLFCFPPISGFG
IYFKDLALLLNEKAAVYGFHFIEQDTRIEQYVNCMTDIQPEGPYVLLGYSAGGNLAFEVA
QAMERKGLEVSDFIIVDAYLKEQPLPIDTGNDESAAYLPEAVREKVMKKKRNYQEYWAQL
LNEGHIKASIHFIEAGIHPETSGHTGLTKWEGACGNYSEYTGFGAHKDMLEGTYAEKNAD
IILDILEKITSNQVILHKR
NT seq 3840 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaggtgcagacactatgaataccattaaaaaaatcaagaacatttatcctctg
agtcatatgcaggaagggatgctgtttcattccttcctccgtaaagaggagggggcgtat
gttgagcagtcgctcttcaccattaaaggaagcctcagctatgactggttccagcgcagc
attcaagccattatcgaccgccatgatattttcagaaccgtgtttttgccgcacgtcccg
catttgtcgggacctcggcaagtcgtgatgacagaacgtgaattccatttgaacagcgaa
gacatttctcatctgccgacaaacgaccagaatgagtatattgaacgctttaaagagaag
gacaagcaaaaaggctttgatctgcaaaaagacatgctgatgcggatttctctattcaaa
acagctaaagatgagcatgtctgtatctggagtcaccatcacattttaatggacggatgg
tgcctaggtatcgttatgcaggaatttatgcaaatttatcaatcgattcatgcaggaaaa
ccgctttcattagaccctgtccgtccgtacagcacctatatttcatggctgacaaaccga
gacaaagaaaaagcagcggcctactgggatacctatttaaaaaactacagcgctccatca
cctctgcctcgtgtgtctgataaagaaacaaaagaaagttatcaccgtgaagatttgata
ttttcattaaataaaccactgacagacaagctgaaagagactgccaaacaacacggcgtc
acgctcgctacccttattcaggcagtctggggtgtgatgctgcagcaatataaccgcaca
gacgacgttgtgtttggcgcagttgtatcaggaagaccgtcagaaatcccaggcgtggag
caaatgatagggttgtttatcaataccataccgattcgaattaaaacacaccaagacgaa
acgtttcacgagctgctcatacgctgccagaaagaaatgctggaagctgagccgtttacc
tgccagcctttatttgatattcaggcaaacaccgcattaaaacaggaactgattgatcac
attatcgtctttgaaaactatccgttacagcagaaaatcgccgattccgctgatcaaacc
gattcaccgctgcaaatcgatcaagttcaagtatccgagcaatcaggatataactttaat
cttgtcgttgctcctggcgaagagcttgtcatcaagttcagctataatgcattcgtttac
gatgctgcctggatcagctgtatcaagaggcaatttacgcaagcgcttagcacagctgca
cagcaccctcatatgccaattgctgatttttcttttcttgatgcaacagaaaaagagcag
attgtcacacagttcaacaatacaaaaacggagtatccaaagaatcatacaattatcgat
ttatttcgcgaacaagcagaaaagacgccagaccataccgcacttgtgtatggcaatatg
tctatttcgtataaagagcttgataaacgctctaatgcgctcgccagagagttaattcaa
aagggatttcggaaaaacgagacagccggaatattggctgcacattctcccgaattcatg
atcagtgtgcttgccgtattaaaagcagggggagcatacctcccgcttgatgcggagctt
ccgcctgaacgagtcagctttatgcttgaggaaacgcaggcaaaaatgctgattgttcaa
aagggattggagcaaaacgctgcgttctcaggaacatgtatcatttcagatgcgcaggga
ttgatggaagagaacgatatccctattaatatcagctccagcccggatgatcttgcgtac
atcatgtatacctcaggatcaacaggccggccgaaaggggtcatgatcacgaatcgcaat
gtcgtgtcccttgtcagaaacagcaattacacgtctgcgtccggtgatgaccggtttatt
atgactggatctatcagctttgacgccgtcacctttgaaatgttcggggcacttttaaat
ggcgcaagccttcatatcattgataaatcgacaatgctgacacctgatcggtttggagcg
tatttgcttgaaaatgacattacagtgctatttttaacgacagctctttttaatcagctg
gcacaggtacgagctgacatgtttcgcggactccatacgttatatgtcggaggagaagca
ctctctcctgccctgatgaatgccgtcagacacgcctgtccagatctcgcgcttcataat
atttacgggccaacggaaaacacgactttttcaaccttttttgaaatgaagagagactat
gcggggccgattccgattggaaaaccaatcagtaatagcaccgcttacatcttagataca
aaaggacgtcttttgccaataggcgttcccggcgagctttgtgttggcggtgatggagtc
gctaaaggctatttgaacagagtagatctgacaaatgctgtgttttctcctcatcctttc
ttgcctggagaaagaatataccgtactggtgatttggcgcgctggctgcctgatggaaac
ttagaatacatcagcagaattgacaggcaaatgaaaatccgcggaaaacgaattgagcct
gccgaaatagaagcgcgcctgttagaaatggaaggcgttcaagaagcagcagtgacattg
agagaaaaagatggagaggcgcagctgtacactcattacgtcggtgatcacaaaaaaaca
gatacggattttcgcgccgatttggcgcgtgtgcttccagactatatgatcccgcagcac
tgggtgcgtgtggagcggatgccgcttaccggaaacggaaaaatagaccgcagcgcgctg
cctattccagaaaataagcctgccaaacgacagaacatcatattgccaagaaacttggtt
gaagaagaattggcgaacatttggaagcaagtcctcggtgttaacacaatcagtattgat
gatgacttctttgctattggcggacattcactaagagcactgcaagtcatacatacacta
aaacatcagcagaacattgacataccgattgatttcttgttcgaacatccgacaatcgct
cagcttgccgaaaaactttattctaaacagctgacagcagcaaatgaacagcatgtgatc
aaactgaaccagcacggcgcgcaaaatcttttctgcttcccgccgatatcgggatttggc
atttattttaaagaccttgctttattgctgaatgagaaggcagccgtatacgggtttcac
tttattgaacaagacacccgcattgaacaatatgttaattgcatgacggacatacagcct
gagggcccatacgttttattaggctactctgcaggcggaaacctggcttttgaagtggca
caggctatggagcgcaaaggattagaagtcagcgacttcattatcgtggacgcttatcta
aaagaacagcctttgcctatcgataccggtaatgacgaatctgcagcatatctgcctgaa
gcagtcagagaaaaggtgatgaagaaaaaaagaaactatcaggaatattgggcacaattg
ctgaatgaaggccacatcaaagcaagcattcatttcatcgaagctggaatccaccccgaa
accagcgggcatacaggcttaacgaaatgggaaggcgcctgcggaaactatagtgagtac
acgggttttggcgctcataaagacatgctggaaggaacatatgctgaaaagaatgccgac
atcatcctcgacattttagaaaagatcacttcaaatcaagtaatactgcacaaacgataa

DBGET integrated database retrieval system