KEGG   Bacillus subtilis subsp. subtilis 168: BSU18310Help
Entry
BSU18310          CDS       T00010                                 

Gene name
ppsD
Definition
(RefSeq) plipastatin synthase subunit D
  KO
K15667  fengycin family lipopeptide synthetase D
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BSU18310 (ppsD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU18310 (ppsD)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    BSU18310 (ppsD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Transferase
Motif
Other DBs
NCBI-GeneID: 940013
NCBI-ProteinID: NP_389713
Pasteur: BG11961
BSORF: BG11961
UniProt: P94459
Position
complement(1964045..1974856)
Genome map
AA seq 3603 aa AA seqDB search
MTKANSIQDIYPLSYMQEGMLFHSLLQKDSQAYVEQASFTIEGKVNPQFFQNSINALVER
HDIFRTIFISQNVSSPQQVVLRERNVIVLEEDITHLNEAEQSQFIEQWKEKDRDRGFHLQ
KDVLMRIALIQTGESQYSCIWTFHHIMMDGWCLSIVLKEFLHIYASYVNASPITLEPVQP
YGKYIKWLMEQDKEQAVSYWDHYLSGHEQQTVLPKQKKTKGKSRQEHVTFSFSKEESSRL
SELAAREEVTLSTIFHTIWGILLQKYNNNDDAVFGSVISGRPAEIEGIEHMVGLFINTMP
VRVQGAKTPFLQLIKDMQKDRLAAEAYSYHPLYEIQSRSAVKQGLIDHILVFENYPVQQE
IQMLNKQEHASDLFQIHNFTVADETNYSFYLMVAPGEEIHIKMNYDAEQHDRSFVLSVKE
HLLNAVSQILNNPNLPPEEIDITTDTEKRQLIGEITDQTPVYETIHAMFEKQAEKTPDAH
AVIDQACSLTYRELNKAANRLARHLRMKGVVRQEPVAIMMERSAAFITGVLGILKAGGAI
VPVDPHYPADRIRYILHDCGCSHVVSQAHLPSSLEDNYIITHPEDIESKVDGSNIKSVNN
ADDLLYMIYTSGTTGKPKGVQFEHRNMANLLKFEYTHSGIDFEADVLQFATPSFDVCYQE
IFSALLKGGTLHIVPEAIKRDVPQLFAFINKHQTNIVFLPTAFIKMIFSERELANSFPDG
VKHLIAAGEQLMISDLFQDVLRKRGIHLHNHYGPSETHVVSTYTIHPGDPIPELPPIGKP
IGCTDLYILNHQKQLQPCGVPGELYISGASVARGYVNHDKLTSDKFSSDPFKPDVIMYRT
GDLARRLEDGNIEYIGRADNQVKIRGYRIEPQEIEVTLMNHPDISEAAILIWQDQNGEHE
LCAYYCSVQKLNTIDLRSYMASELPEYMIPAKWIWVDSIPLTPNGKVDRAALPEPDASIS
GNPYTAPRNLLEAKLSQLFEDVLKNGHIGIQDNFFDNGGHSLKATVLMSRIAKEFHVQVS
LKDIFAHPTVEGLALIIREAEQNLYAAIEPAEKRDTYPVSSAQKRIYVLQQLDEGVAYNM
PAVLELEGALDVAKLSAVCKELISRHEPLRTSFVSGADDEPVQRIHTEVPFTLSKETTIE
GFVRPFDLSQAPLFRAGLIEVSNEKHVLLVDMHHIISDGVSVQLLIREFTDLYANRQLKP
LRIQYKDYAVWQQKFKKGDSYQKQETYWQQQFSGDLPILELPTDKRRPAERQFIGGKVTF
QLDKEITARIKRLAHKNRSTLYMTLLALYSAFLSRLSGQDDIVIGSPIAGRPHADLEAVL
GMFVNTLALRTRPAGNKTFEEFLKEVRQTALEAYEHQDYPFEELVDKLGVQREMSRNPLF
DTTLVLQNMEQQKLKMNDVQLQWNDLEHPISKFDISLYVTEHDSELFCQFEYSTALFEKE
TIQRWASLFTTLVEHTAASPETELDNIPILTKEEERDFIESCHLFEETGYSMNQTLHYAL
EQQAEKTPDQAAVIFEDGVMTYKELNEQANRIAWELIGRGVKPETTVAIIGKRSPEMLLG
IYGILKAGGAYLPIDPDYPEERISFLLEDSGTNILLLQSAGLHVPEFTGEIVYLNQTNSG
LAHRLSNPNVDVLPQSLAYVIYTSGSTGMPKGVEIEHRSAVNFLNSLQSRYQLKHSDMIM
HKTSYSFDASIWELFWWPYAGASVYLLPQGGEKEPEVIAKAIEEQKITAMHFVPSMLHAF
LEHIKYRSVPIKTNRLKRVFSGGEQLGTHLVSRFYELLPNVSITNSYGPTEATVEAAFFD
CPPHEKLERIPIGKPVHHVRLYLLNQNQRMLPVGCIGELYIAGAGVARGYLNRPALTEER
FLEDPFYPGERMYKTGDVARWLPDGNVEFLGRTDDQVKIRGYRIEPGEIEAALRSIEGVR
EAAVTVRTDSGEPELCAYVEGLQRNEVRAQLERLLPGYMVPAYMIEMEQWPVTPSGKLDR
NALPAPGGAADAETYTAPRNVTEMKLSQLWEDVLKNGPVGIHDNFFDRGGHSLKATALVS
RITKEFDVQVPLKDVFAHPTVEGLATVIREGTDSPYEAIKPAEKQETYPVSSAQKRIYVL
QQLEDGGTGYNMPAVLELEGKLNPERMDRAFQELIKRHESLRTSFEQDEGGDPVQRIHDE
VPFTLQTTVLGARTEQEAAAAFIKPFDLSQAPLFRAQIVKVSDERHLLLVDMHHIISDGV
SVNILIQEFGELYNNRKLPALRIQYKDYAVWQEGFKTGDAYKMQEAYWLKQLEGELPVLD
LPADHARPPVRSFAGDKVSFTLEPEVASGLHKLARENGSTLYMVLLAAYTAFLSRLSGQE
DIIVGSPIAGRPHKDLEPILGMFVNTLALRTRPEGGKPFVQYLQEVRETALEAFEHQNYP
FEELVDKLELTRDMSRNPVFDAMLVVQNNDYEPLHLHDLQMKPAQVSHLVSKFDLTLQAS
EGDGNIHFLFEYSTALFEKTTIERWASHLTNVLSIIGKNPKVTLNHIDILTQEERHQLLN
EFNTGQANQYGVQTISQLFEQQAARTPKASALVSGDKTLTYQELDEWSNGIARALRSRGV
KPDTPVGIMMHRSFSMIASILGVWKAGGCYVPIDPEYPKERKRYILSDSGTKLLMTINEA
DLGVLADFEGEILTIESVEEDDKSPLPQMSSAHHLAYIIYTSGTTGRPKGVMVEHKGIAN
TLQWRRNAYAFNETDTILQLFSFSFDGFITSMFTPLLSGAKAVLLHEEEAKDILAIKHQL
SRQRITHMIIVPVLYRALLDVVQPEDVKTLRVVTLAGEAADRELIARSLAICPHTELANE
YGPTENSVATTVMRHMEKQAYVSIGQPIDGTQVLILNSNHQLQPIGVAGELCIAGTGLAR
GYVNLPELTERAFTQNPFKPEARMYRTGDAARWMADGTLEYLGRIDDQVKIRGYRVETKE
IESVIRCIKGVKDAAVVAHVTASGQTELSAYVVTKPGLSTNAVRSELQNKLPVFMHPAFI
EKLDSLPLSPNGKLDRGALPKPVYNHEGERPFLPPSSKMEQILADIWKEVLGAEKIGTAD
SFFELGGDSIKALQVSARLHRIGKQMAVKDLFSHPTIQELAAYIRDSDTSSSQAAVEGDV
QWSPVQKWFLSQDIKEKHHFNQSVMLHRSTSVQEDALRKTLKAITCHHDALRMVFTQNEQ
GKWDQYNRPLSHSDDALYGLQMIDLSAPDGTDGNRPYEPLIKRHVLDIQQKMDLKNGPLL
QAGLFHTIDGDFLFLSAHHLVVDGISWRVLLEDLALGYRQAAGGEDIKLPPKTSSFKAYA
KKLSDYAESQQLMKQLKYWREAEEYQTEALPFDQIDGTRAHEGQRSTISFTLNDKETAAL
LKDANSAYNTDTQDMLLASVILALRHWTNQSAFKLSLEGHGREDVLKGIDVSRTIGWFTA
IYPLLIKLNADLPDSEESMVHVLKTTKDTLRRVPDKGFGYGVIKYLTPPGKKDINFTGAP
EISFNYLGQFESGRTAEVPEEDAFSFSPLGAGGDISTTWNREQSLDISAIAAEGKLTVNM
TYDNARFQRKTIEQLSETCRQFLLQLIEHCQNKSETEKTISDFDDQELTEDALQEIADML
SFH
NT seq 10812 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagcgaattcaattcaggatatttatccgctgtcttacatgcaggaagggatg
cttttccattccctcctgcaaaaagattcacaggcgtatgttgagcaagcttcttttaca
atagaaggaaaagtcaacccgcagttttttcaaaacagcatcaacgctcttgtagaaaga
catgatattttcagaacgatttttatcagccaaaatgtttcctccccccagcaggttgtt
ctgagagaacgaaatgtcatcgtactggaagaagacattactcatttaaacgaggcggag
caatcacagtttatcgagcaatggaaagaaaaggaccgggaccgggggtttcatttgcaa
aaggatgtgctcatgcgcatcgctctgattcaaacaggagagagccagtactcttgcatt
tggacctttcatcatatcatgatggacggttggtgcctcagcattgtgctaaaggagttt
ctgcatatttacgcatcttatgtaaatgcatccccaataacattggagccggtccagcca
tacggaaagtatatcaaatggctgatggagcaagacaaagagcaggcggtttcttattgg
gatcattatctttccggccacgaacagcaaaccgtgctcccgaagcagaaaaaaacaaag
ggaaaaagcaggcaggaacacgttacattttcattctctaaggaagaaagcagcaggctt
tcagagcttgctgctagagaagaagtgacactcagtacgatttttcataccatttggggc
attctgctgcaaaaatataataataacgatgacgccgtattcggttctgtcatttcagga
agacccgcagaaatcgaaggcattgaacatatggtaggtcttttcattaatacgatgccg
gttcgggtgcagggggcaaaaacgccttttcttcaacttataaaagatatgcaaaaagac
cgtcttgccgctgaagcgtacagctaccaccctttatatgagattcaatcccgctcagct
gttaagcaagggctgattgatcatattctcgtatttgaaaactatccggtgcagcaagag
attcaaatgctgaacaaacaggaacatgcttctgatctttttcagattcataatttcact
gtcgcagatgaaaccaactacagcttttatcttatggtggcgccaggggaagaaattcat
atcaaaatgaactatgatgcggagcagcacgatcggtcttttgtgctctctgtcaaagag
catcttctgaatgctgtatcacaaatcttaaataatccgaatcttccacctgaagaaatc
gatatcacgacagatactgaaaagcggcagctgattggagaaatcacagatcaaacacca
gtttacgaaaccatccatgccatgtttgaaaagcaagcggaaaagacaccagatgctcat
gctgtaattgatcaagcctgctcattaacatacagagaactgaataaagcggctaacaga
ttggcacggcatttacgaatgaaaggcgttgtgagacaggaacccgttgcgattatgatg
gaacgctcagcggcgtttatcacaggtgttcttggtatcttgaaagcaggcggcgccatt
gttccggttgatccgcattaccctgctgacagaatccgttatattctgcatgattgcggc
tgttcgcatgttgtttcacaagcgcatcttccctcatcgttagaagacaattacattatc
actcatccagaagatatcgaaagcaaagtagacggcagtaacataaagtcagtcaacaat
gctgacgatctgctgtatatgatttatacatcaggcacaacaggtaaaccaaagggtgtt
caatttgagcatcgaaacatggctaacttgctgaagttcgaatatactcactccggcatt
gactttgaagcagatgttctgcaatttgcgacgccttccttcgacgtctgctatcaagaa
atattttctgcgcttctgaaaggcggcacactccacatcgtgccagaagccataaaaaga
gatgtgcctcagctgtttgcatttataaacaagcatcagacgaatattgtgtttctccca
actgcttttatcaaaatgattttcagcgagcgagaacttgcgaactcgtttcctgatggc
gtcaaacacctgatcgcagccggggaacaattaatgatttcagaccttttccaagatgtg
ttgcgtaaacgcggcatacacctgcacaatcattacggaccttcagaaactcatgtggta
tctacgtataccattcatcctggagaccctattcctgagcttccgccaatcggtaaaccg
ataggctgtactgatctatatattttgaatcatcaaaaacagcttcagccatgcggcgta
ccaggcgaactctatatttccggcgcaagtgttgccagaggatatgtcaatcacgataaa
ctgacaagcgacaaattttcatccgatccattcaagcctgatgtgatcatgtaccggaca
ggtgatttggccagacggcttgaagacggcaacatcgaatatatcggacgggcagacaat
caagtgaaaatcagaggttatcgaattgagccgcaagaaatcgaagtcacgctaatgaat
catccggacattagtgaggctgccattctcatctggcaagatcaaaacggtgaacatgaa
ttatgcgcttactattgcagtgtacaaaagctgaacacaatagatttacgcagttatatg
gctagtgagctcccagaatacatgattccggcgaaatggatatgggttgacagcatacct
cttaccccaaacggaaaagtagatcgcgcagcacttccggagccagatgcttcaatcagc
ggaaacccatatactgcccctcgaaatctgttagaggcaaagctttcgcaactatttgaa
gatgtgctaaagaatgggcatataggcatccaagacaacttttttgacaatggcggtcac
tcgttaaaagcaacagtgcttatgtcacggatcgcaaaggaattccatgtgcaagtttca
cttaaggacatctttgctcatccgactgttgaaggattagctttaattattcgagaggca
gaacaaaatctgtatgcagcaattgaaccagcagaaaaaagggatacatatcctgtatct
tcggcccaaaaacgaatctatgtgcttcaacagcttgatgagggtgtcgcctataacatg
cctgcggtcttagaactggaaggtgcactggatgtcgccaaactgtctgctgtatgtaaa
gaactgatcagccggcatgagccgcttcgaacttcctttgtatccggagctgatgacgag
ccggttcagcgtatccacaccgaagtgccgtttacgttaagtaaagagaccactatcgag
ggatttgtccgtccctttgatctcagccaggcgccattatttagagcaggccttatagaa
gtgtcaaacgagaagcatgtattgctggtggatatgcaccatatcatttcagatggcgta
tccgttcagctcctaatccgagaatttaccgatctttatgcaaaccggcagcttaagcca
ttgcggatccaatataaagattacgccgtatggcagcagaaatttaaaaagggagactcg
taccaaaagcaggagacttactggcagcagcagtttagcggggaccttcctatactggag
cttccaacagataaacgacgtccggcagaacggcaattcataggcggaaaagtaaccttt
caattggacaaagagatcacggcccgcataaagcggctcgcccataaaaacagaagcacg
ctttatatgacgcttctcgctttgtattcagcctttttgtctcggttaagcggtcaggat
gatatcgtgattggttcacctatcgccggacggccccatgccgaccttgaagctgttctt
gggatgttcgtcaatacattggctctccgcacacgcccggcgggtaataagacatttgag
gaatttctgaaagaagtcagacagacggcactagaagcgtatgagcatcaggattacccg
tttgaagagcttgtggacaaactcggtgtgcagcgggaaatgagccggaatcctttgttt
gacacaacgctagtccttcagaatatggaacagcaaaagctaaaaatgaatgatgtacag
cttcagtggaacgacttggagcacccaatatcaaaatttgatatttccctatacgttaca
gagcatgattccgagcttttctgtcagtttgaatacagtacagctttgtttgagaaagaa
accatccaaaggtgggccagccttttcaccacgcttgtggaacatacagctgccagtcct
gaaacagaattggacaatattccaatcttaacaaaagaagaagagcgagatttcattgaa
tcatgccatctgtttgaggagacgggctattcaatgaatcaaacgctccactatgcactc
gaacagcaggcagaaaaaacgcctgatcaggcggccgttatcttcgaagatggagtgatg
acctataaagaattgaacgaacaggctaaccgtatcgcctgggagctgatcggacggggg
gtaaaacccgaaacgactgttgccattataggaaagcgttcacctgaaatgctgcttggc
atttatggcattcttaaagctggcggcgcttatctgcccatcgacccggattatccggaa
gaacgaatcagctttctgctggaggacagcggtacaaacattctcctgcttcagtctgcc
ggccttcatgttccggaatttacaggagagattgtctatctcaatcagacaaatagcgga
ctggcacatcgtttgtccaatccgaatgtggatgttctcccgcaatctttagcctatgtc
atctatacatccggctctaccgggatgcctaagggtgttgaaattgaacatcgatcagcg
gtgaattttttgaattccctacagtcccgctatcagctaaagcattcagatatgattatg
cacaaaacatcatattcattcgatgcttcaatatgggagctgttttggtggccttatgcc
ggagcttctgtttatctgcttcctcagggaggcgaaaaagaacctgaagtgatcgcgaag
gccatagaagaacaaaagatcacagctatgcattttgtgccttcaatgctccatgcattt
ttagaacatataaaatatcgctctgtaccgattaagacaaacagactcaagcgagtgttt
tctgggggagaacagctggggacccatcttgtctcccgattttacgagttgcttccaaat
gtttcaataaccaattcctatgggccaacggaagcaaccgtagaagctgcattctttgat
tgtccgccgcatgaaaaacttgaacggatcccaattggaaaacctgttcatcatgtcaga
ttatatctcctgaatcagaatcagcggatgctgcctgttggatgtatcggcgaactgtac
atagccggagcgggtgttgccagaggttatttgaatcggccggcattaacggaggagcgt
tttcttgaagacccgttttacccgggtgaacgcatgtacaaaaccggggatgtggcgcgc
tggctccctgacgggaatgttgaattcctcgggcgcacggatgatcaggtgaaaatccgc
ggctaccggattgagccgggagaaattgaagcggcactaagaagtatagaaggtgtaaga
gaggcggccgttaccgtacggacagacagcggggagccggaattatgcgcttatgtagaa
gggctccaaagaaacgaagtccgagcgcagcttgagagactgttgccgggctacatggtc
ccagcctatatgatagagatggaacagtggccggttacgccaagcggaaagctcgaccga
aacgccctgccagctcctggcggagcggcagatgcggagacctacacagcgccgagaaac
gtgactgagatgaagctttctcagctgtgggaggacgtgctgaaaaatggccctgtcggg
attcacgacaacttttttgaccgcgggggacattccttaaaagcaacggcgcttgtctca
cggatcaccaaagaattcgatgtacaggtgccgctaaaagatgtgtttgcccatccgacg
gtagaaggactggctaccgttatccgtgaaggaacggacagtccatatgaagcgattaag
cccgctgaaaaacaggaaacctatccggtttcctctgcccaaaagcggatttatgtcctt
cagcagctggaggacggagggacaggctacaatatgccggctgtgttagagctcgaaggg
aagctcaaccctgaaaggatggacagagctttccaagagctgatcaagcgccacgagtcg
cttcgaacctccttcgaacaggacgaaggaggcgatccggtgcagcgcatccatgacgag
gtgccgtttacgttacagactacagttctcggcgcacgaaccgaacaggaggccgcagcc
gcatttatcaaaccgtttgatctcagccaagcgccgctgttccgtgcccaaatcgtaaag
gtatcagatgagcggcacctattgctggttgatatgcatcacatcatttcagacggtgtt
tccgtcaacattctgattcaagaattcggcgagctgtacaataatcggaagcttccggcg
ctgcgcattcaatataaagattatgccgtatggcaagaaggattcaaaacaggagacgcg
tacaaaatgcaggaggcgtactggctgaagcagctcgagggcgagctgcctgtgctggat
ctccccgctgatcatgcccgcccgccggtgcgaagcttcgcgggtgacaaggtctcattt
acgctggaaccagaggttgcatcaggccttcacaagctggcacgagaaaacggaagcaca
ctgtacatggtgctccttgcggcttacaccgcgttcttgtcacgcttaagcggacaggaa
gatatcatcgtcggctcgccaatcgccggccggccgcacaaggatcttgagccgatactc
ggcatgtttgtgaacacgctggcgcttcggacgcgcccggagggcgggaagccattcgta
cagtatttgcaggaagtgcgtgagacagcattggaagcctttgagcaccagaattacccg
ttcgaagagcttgtcgataagcttgaattgacacgagatatgagccggaacccagtgttt
gatgcgatgttagttgttcaaaataatgattacgagccattgcatcttcatgatttgcaa
atgaagccggcacaagtttctcatctcgtttctaaattcgatttgacactacaggcatct
gagggcgacggaaacattcatttcctttttgaatattcaaccgcattgttcgagaaaacc
accattgaacgctgggcatcgcatttaacaaatgtacttagcatcatcggcaaaaacccg
aaggtgacactcaaccatatcgacatcctgacccaagaagagcggcaccagctgcttaat
gagtttaacaccgggcaagcgaatcaatacggagttcaaacaatcagtcaattgtttgag
cagcaagctgcacgaacaccaaaagcttctgcacttgtcagcggagacaaaacactcact
tatcaggagcttgacgagtggtccaatggaatcgcacgtgcattgcgcagccgaggtgtt
aagccggacacaccagtaggcatcatgatgcatcgttcgttcagtatgatagcatccata
cttggtgtgtggaaagccggaggctgttacgttcccattgatcctgaatacccgaaagaa
cggaaacgctatatcctcagcgacagcggaacgaaactgctgatgacaataaatgaagcg
gatctgggagtacttgctgactttgaaggagagatcttgacgatagaaagcgtagaggaa
gacgacaaatcgccgctgccgcaaatgtcgtctgcccatcatttggcttatatcatttat
acttcaggaacgacgggccgtccaaaaggggtaatggtcgagcataaagggattgctaac
actcttcagtggcggcgaaacgcttatgcattcaacgagacagataccattctgcagctc
ttttctttctcatttgacggctttataactagtatgtttacaccgcttttgtcaggtgca
aaagccgttttgcttcatgaagaggaagcgaaggatattctggccattaagcatcagctg
tctcgtcaacggattacacatatgattattgtgcctgttttatatcgagcgcttttggac
gtagtgcagccggaagatgtaaagacgcttagagtcgtcacactggcgggagaagcggct
gaccgcgaattgatcgcccgcagcttagctatatgtccgcataccgaactcgccaacgaa
tatggaccgacagaaaacagcgtggcgactaccgtcatgagacatatggaaaagcaggca
tacgtaagcatcggccagccgattgacggaactcaagtgctgattttaaatagcaatcat
cagcttcagccaatcggtgttgcgggagagctttgtatagcaggaacagggcttgcaaga
gggtacgttaatcttccagaactgacagagagagcattcacgcagaatccatttaaaccc
gaagcacgaatgtaccgaacaggagacgccgccagatggatggccgacggtacactcgaa
tatctcggaagaatcgatgatcaagtcaaaatcagaggataccgtgtagaaacgaaagaa
attgaatcggtcatccggtgtataaagggtgtaaaagacgccgcagtagttgctcatgta
acagcgtcaggacaaaccgaattaagcgcttatgtggtgacaaaaccagggttgagcaca
aatgctgtacgctcagaattacaaaacaagctgccggtgtttatgcaccctgcgtttatt
gaaaaactggactcacttccattgtcaccaaacggcaagctggatcgcggagcacttcca
aaacctgtatacaaccacgaaggtgaacgtccattcctcccgccatccagcaaaatggaa
caaatactggcagatatatggaaagaagtactgggggcagaaaagatcggaacagctgat
tcgttctttgaacttggcggagattcaatcaaagcgttacaggtatctgcgcggcttcac
cggataggcaagcaaatggcagtgaaagatttgtttagccatccgaccattcaagaattg
gcagcttatatccgtgattcagatacaagttccagccaagctgcggttgagggagacgta
caatggtcgcctgttcaaaaatggtttctttctcaagatataaaagaaaaacaccatttt
aatcagtccgtaatgctgcatcgaagcacctctgtacaagaagacgcactgcgaaaaacg
ttaaaagcaataacgtgtcatcatgatgcgctgcgaatggtgtttacacagaatgaacaa
ggaaagtgggatcaatataatcggccgctcagtcattcggacgacgcgttgtacggcctt
cagatgattgatttgtcagctccggacggcactgatggaaatagaccgtatgaacctctt
atcaagcgccatgtacttgatattcagcagaaaatggatttgaagaatggtccgctgctg
caagccggtcttttccacacaattgacggtgatttcttatttttatctgctcatcacctc
gtcgttgacggcatctcatggcgggttctgcttgaagatttggctttagggtatcgccaa
gctgctggcggggaggatatcaaactgccgcctaaaacaagctcgtttaaagcgtatgcg
aaaaagctctctgactacgctgaaagccagcagctaatgaaacagctcaagtattggcgc
gaagccgaagagtatcaaacagaggcattgccttttgatcaaatcgatggaactagagca
cacgagggacaacggtccacaatttcgtttaccttaaacgataaagagacagcagcactc
ttaaaagacgccaacagcgcatataacactgatacgcaggacatgctgctcgcttctgtc
attcttgcgctgcgccattggaccaatcaatccgccttcaaactatcattagagggccac
gggcgagaggatgtattaaaaggaatagatgtgagccggacgattggatggtttaccgcc
atttatccgttattgattaaactgaacgcagacttgccagattcggaagaaagcatggtt
catgtgctaaaaacaacaaaagatacactgagacgtgtacctgacaaaggattcggctac
ggtgtcatcaaatatttgactccgcctggcaaaaaagacatcaatttcacaggtgcacca
gaaatcagctttaattatcttggtcaatttgaaagcggccgcacagctgaagtacctgag
gaggacgccttctcattctctccgctgggtgccggaggtgatatcagcacaacatggaac
cgtgaacagtcgctggatatcagcgcaatcgctgcagaaggaaaattgactgtcaatatg
acttatgacaatgcccgctttcagcgcaaaaccatcgaacagcttagcgaaacatgccgt
caatttttattacagctgatcgaacactgccagaacaaaagcgaaacagaaaagacgatc
agtgattttgatgatcaagaactgaccgaggacgccctgcaagagatcgctgatatgctc
agttttcactaa

DBGET integrated database retrieval system