KEGG   Bacillus subtilis subsp. subtilis 168: BSU18320Help
Entry
BSU18320          CDS       T00010                                 

Gene name
ppsC
Definition
(RefSeq) plipastatin synthase subunit C
  KO
K15666  fengycin family lipopeptide synthetase C
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BSU18320 (ppsC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU18320 (ppsC)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    BSU18320 (ppsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Transferase
Motif
Other DBs
NCBI-GeneID: 940102
NCBI-ProteinID: NP_389714
Pasteur: BG10972
BSORF: BG10972
UniProt: P39847
Position
complement(1974881..1982548)
Genome map
AA seq 2555 aa AA seqDB search
MPQQPEIQDIYPLSFMQEGMLFHSLYDEQSRAYFEQASFTIHGQLDLERFQKSMDAVFDR
YDIFRTAFIYKNVAKPRQVVLKQRHCPIHIEDISHLNERDKEHCTEAFKEQDKSKGFDLQ
TDVLMRISILKWAPDHYVCIWSHHHILMDGWCLGIVIKDFLHIYQALGKGQLPDLPPVQP
YGTYIKWLMQQDREEAAEYWKKRLQHFEKSTPLPKRTDQIPNGTLQQITFAIPEKETAEL
QKIAAASGATLNTVFQALWGIMLQKVNRSSDAVFGSVISGRPSELKDVENMVGLFINTIP
IRAQSDSLSFSDLVRRMQKDMNEAEAYSYFPLYDIQAQSALKQELIDHIIVFENTPTQQE
IEELNQAGSFDFSVKDFEMEEVTNYSCSVKVIPGRTLYVRIHFQTSAYQPSMMSEIKDYL
LHMVSDVISDPSLPVSKMTLLDEDKTRKIVSQNNRTVSVSPEAPTLHGLFERQAAVTPER
LAIRFSGGSLTYAELDMYASRLAAHLAARGVTNESIVGVLSERSPDMLIAVLAVLKAGGA
YLPLDPAYPKERLSYMLKDSGASLLLTQPGCSAPNFSGETLEVDMTSLECEEVKRHVSAS
VSDGSLAYVIYTSGSTGQPKGVAVEHRQAVSFLTGMQHQFRLSEDDIVMVKTSFSFDASV
WQLFWWALSGASAYLLPPGWEKDSALIVQAIHQENVTTAHFIPAMLNSFLDQAEIERLSD
RTSLKRVFAGGEPLAPRTAARFASVLPQVSLIHGYGPTEATVDAAFYVLDPERDRDRLRI
PIGKPVPGARLYVLDPHLAVQPSGVAGELYIAGAGVARGYLNRPALTEERFLEDPFYLGE
RMYKTGDVARWLPDGNVEFLGRTDDQVKIRGYRIEPGEIEAALRSIEGVREAAVTVRTDS
GEPELCAYVEGLQRNEVRAQLQRLLPGYMVPAYMIEMEQWPVTPSGKLDRNALPAPGGAA
DAETYTAPRNVTEMKLSQLWEDVLKNGPVGIHDNFFDRGGHSLKATALVSRIAKEFDVQV
PLKDVFAHPTVEGLATVIREGTDSPYEAIKPAEKQETYPVSSAQKRIYVLQQLEDGGTGY
NMPAVLELEGKLNLERMDRAFKELIKRHESLRTAFEQDAGGDPVQRIHDEVPFTLQTTVL
GARTEEEAAAAFIKPFDLSQAPLFRAQIVKVSDERHLLLVDMHHIISDGVSVNILIREFG
ELYNNRKLPALRIQYKDYAVWQEGFKTGDAYKTQGAYWLKQLEGELPVLDLPADHARPPM
RSFAGDKVSFTLDQEVTSGLYKLARENGSTLYMVLLAAYTAFLSRLSGQEDIIVGSPIAG
RPHKDLEPILGMFVNTLALRTRPEGGKPFVQYLQEVRETAMEAFEHQDYPFEELVDKLEL
TRDMSRNPLFDVMFVLQNMDQESLELDELCLKPAANNGHQTSKFDLTLYAQEQPRGLLTF
QMEFSTDLYKKKTIEKWLQYFNNMLLSIIKDNKAALGTINILNEDEAHYLIHELNRTKID
YPRNETISRLFEMQAEQTPNAVAIVSDTQVFTYEDLNSWANQIASVLQIKGVGPDSVVAL
LTGRTPELIAGMLGILKAGGAYLPIDSNLPVERIAYMLSDSRAALLLQSEKTEKRLLGIE
CEQIIIEDIQKQGEAKNVESSAGPHSLAYIIYTSGSTGKPKGVMIEQRSVIRLVKNSNYI
TFTPEDRLLMTSSIGFDVGSFEIFGPLLNGAALHLSDQQTFLDSHQLKRYIEHQGITTIW
LTSSLFNHLTEQNEQTFSQLKHLIIGGEALSPSHVNRIRNVCPEVSIWNGYGPTENTTFS
TCLHIQKTYELSIPIGRPVGNSTAFILNQWGVLQPVGAVGELCVGGDGVARGYLGRPDLT
KEKFVPHPFAPGDRLYRTGDLARWLSDGTIEYVGRIDDQVKVRGYRVELGEIETALRQID
GVKEAAVLARTAQTGSKELFGYISVKAGTNAEQVRSLLARSLPNYMIPAYIIEMETLPLT
SNGKLNRKALPEPDVASKQTYIPPRNELEEQLALIWQEVLGIQRIGIEDSFFELGGDSIK
ALQVSARLGRYGLSLQVSDLFRHPKIKDLSPFIRKSERIIEQGPIQGDVPWTPVQQWFFS
QDIEERHHFNQSVMLFHSGRLSENALRPALKKLAEHHDALRMVYRNDDRRWIQINQGIHE
SQLYSLRISDLSQSESGWETKIKQEVADLQQSINLQEGPLLHAALFKTLTGDYLFLAIHH
LVVDGVSWRILLEDLSAGYQQAAAGQTIQLPPKTDSYQEYARRIQEYAQSSKLIREEAYW
RSVEEQQAAELPYEIPHHVNIDFSKRDSLSFSLTEADTAVLLQNVNHAYGTDTQDILLTA
ASLAICEWTGGSKLRIAMEGHGREHILPELDISRTVGWFTSMYPALISFENHRDELGTSV
KTVKDTLGRIPNKGVGYGMLKYLTHPENKSITFSKTPEISFNYLGQFNDIERQDTFRPSS
LGSGKDITHTWKREQIIEMSAMAADKKLHFNLSYPPARFHRNTMEQLINRIEHFLLDIMK
HCAGQQKAEKTLSDFSSQSLTAEDLDSISSLVEEL
NT seq 7668 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagcaacctgaaatacaggatatataccctttgtcatttatgcaggaagggatg
ctttttcactcactgtatgatgaacagtcgagagcttattttgaacaggcttcttttacg
atccatggacagcttgacttggagcgtttccaaaaaagtatggatgctgtttttgacagg
tacgatatctttcgaacagcattcatctataaaaatgtagccaaacctcgtcaagtcgtg
ctcaagcaacgtcattgccctattcatattgaagatatttcccatctcaatgaaagggat
aaagaacattgtaccgaggcattcaaagagcaggacaaatccaaaggctttgatctccaa
acggatgtactgatgagaatatctattttaaaatgggcgcctgatcattatgtctgtatc
tggagccaccatcatattttaatggatggctggtgtttaggcatcgtcattaaagacttt
ctccatatttatcaagcgctgggtaaaggccagcttcctgatttgcctcccgtacagccg
tacgggacgtatattaaatggctgatgcagcaagatcgtgaagaagcagctgagtactgg
aaaaagaggcttcagcatttcgaaaaatctacacccctgccgaaaagaacagatcaaatt
ccgaatgggacactacagcagatcacgtttgccattcccgaaaaagaaaccgccgaatta
cagaaaatcgcagcagcttctggtgcgacactaaacactgttttccaagctttatggggg
attatgcttcaaaaggtcaatcgcagcagcgatgctgtgttcggttcagttatatcaggc
agaccttctgagctaaaagatgtggaaaacatggtcgggctttttatcaataccattcct
attcgagcccaaagtgattctctgtctttttctgacctagtcaggagaatgcaaaaggac
atgaatgaggcagaagcctatagttactttcccttgtatgatattcaggcgcagagtgct
ctaaagcaagagttgatcgatcatattatcgtctttgaaaatacacctacccagcaagag
atcgaagagctgaatcaagcggggtcatttgatttctccgtcaaagattttgagatggaa
gaggtgaccaattatagttgcagtgtcaaagtgatcccaggccgtaccttgtacgttcgg
attcattttcagaccagcgcttatcaaccaagcatgatgtccgaaataaaagattatttg
ctgcacatggtctctgacgtcatctctgatccatctcttcctgtgtcaaagatgacgttg
ctagatgaggacaaaacacggaaaatcgtttctcaaaataacaggacagtatctgtttca
cctgaagccccaaccctgcatgggctgtttgaacgacaggcggcagtcacaccggagcgg
ctggccattcgcttttcaggcggttcgctgacatacgctgagcttgatatgtacgccagc
cggctggctgcgcaccttgcggcacgcggcgtcacaaacgaaagtatcgtcggtgtcctg
tctgaacgctcacctgacatgctgatcgctgtccttgctgtattgaaggccggaggggcg
tatttgccgcttgatcctgcgtatccaaaggagcggctgagctacatgctgaaagacagc
ggggcatcgctcttgctgacacagccgggatgctccgcaccaaacttttctggcgaaacg
cttgaagtggacatgacatctcttgagtgtgaagaagtaaaacgtcatgtgtctgcttct
gttagcgacggatctctcgcctatgtcatctatacatcgggctctaccgggcagccgaaa
ggagtggccgttgagcaccgccaggctgtttcctttctgaccggcatgcagcaccagttt
cggctttcggaagatgacattgtcatggtgaaaacctctttttcctttgatgcgtctgtg
tggcagctgttttggtgggctctttccggtgcttcggcgtatctgcttccgcccggctgg
gaaaaagactccgcattgatcgtacaagccattcatcaggaaaacgtgacaacggctcat
tttattccggctatgctgaacagctttctcgatcaagcggaaatcgaaaggctgagtgac
aggacaagcctaaagcgtgtattcgccggaggtgaaccgcttgcgccgcgtacggcagcc
cgttttgcttctgtattgccgcaggtatcattaatccatggctacgggccgacagaagcc
acggtagacgcggcattttacgtgttagatccagaacgggacagagaccgtttgcggatt
ccgattgggaagcccgtacctggtgcgcgtttgtatgttttagatccgcatttagccgta
cagccttccggtgtcgccggcgaactatacattgccggagcgggtgttgccagaggttat
ttgaatcggccggcattaacggaggagcgttttcttgaagacccgttttacctgggggaa
cgcatgtacaaaaccggggatgtggcgcgctggctccctgacgggaatgttgaattcctc
gggcgcacggatgatcaggtgaaaatccgcggctaccggattgagccgggagagattgaa
gcggcactaagaagcatagaaggcgtaagggaggcggccgttaccgtacggacagacagc
ggcgagccggaattatgcgcttatgtagaagggctccaaagaaacgaagtgcgtgcacag
cttcagagactgttgccgggctacatggtcccagcctatatgatagaaatggaacagtgg
ccggttacaccaagcggaaagctcgaccgaaacgccctgccagctcctggcggagcggca
gatgcggagacctacacggcgccgagaaacgtgactgagatgaagctttctcagctgtgg
gaggacgtgctgaaaaatggccctgtcgggattcacgacaacttttttgaccgcggggga
cattccttaaaagcaacggcgcttgtctcacggatcgccaaagaattcgatgtacaggtg
ccgctaaaagatgtgtttgcccatccgacggtagaaggactggctaccgttatccgtgaa
ggaacggacagtccatatgaagcgattaagcccgctgaaaaacaggaaacctatccggtt
tcctctgcccaaaagcggatttatgtccttcagcagctggaggacggagggacaggctac
aatatgccggctgtgttagagctcgaagggaagctcaaccttgaaaggatggacagagct
ttcaaagagctgatcaagcgccacgagtcgcttcggaccgccttcgaacaggacgcagga
ggcgacccggtgcagcgcatccatgacgaggtgccgtttacgttacagactacagttctc
ggcgcacgaaccgaagaggaggccgcagccgcatttatcaaaccgtttgatctcagccaa
gcgccgctgttccgtgcccaaatcgtaaaggtatcagatgagcggcacctgttgctggtt
gatatgcatcacatcatttcagacggtgtttccgtcaacattctgattcgggaattcggc
gaactgtacaataatcggaagcttccggcactgcgcattcaatataaagattatgccgta
tggcaagaaggattcaaaacaggagacgcgtacaaaacgcagggggcgtactggctgaag
cagctcgagggcgagctgcctgtgctggatcttccggctgatcatgcccgcccgccgatg
cgaagcttcgcgggtgacaaggtctcatttacgctggatcaagaggttacatcaggcctt
tacaagctggcacgagaaaacggaagcacactgtacatggtgctccttgcagcttacacc
gcgttcttgtcacgcttaagcggacaggaagatatcatcgtcggctcgccaattgccggc
cggccgcacaaggatcttgagccgatactcggcatgtttgtgaacacgctggcgcttcgg
acgcgcccggagggcgggaagccgtttgtacagtacttgcaggaagtgcgcgagacagca
atggaagcctttgagcaccaagattacccgttcgaagagcttgttgataagcttgaattg
acacgagatatgagcagaaatccgctgtttgacgtaatgtttgttcttcaaaatatggat
caggaatcgttggagctggatgaactttgtctcaaacctgcagcaaacaatgggcatcaa
acgtccaaatttgatttaaccctatatgcccaggaacagccccgcggtttgctgacgttc
caaatggagtttagtactgacttatataagaaaaaaacgatagaaaagtggcttcaatac
ttcaacaatatgttactctccatcatcaaagacaacaaagccgctctcggaacaataaat
atcctgaatgaggatgaggcccattaccttatccacgagctcaatcgtacaaaaatagat
tatccaagaaatgaaaccatcagcagactctttgaaatgcaggcagaacaaacacctaat
gctgtagcaattgtcagcgacacccaagtattcacttacgaggacctgaacagctgggca
aatcaaattgcctcagttctacagataaagggcgtagggcctgatagtgttgtagccttg
ttgacaggcagaacaccagaactcattgcaggaatgctgggcattctaaaagccggggga
gcctatctgcctatcgattctaatctgcctgttgaacgcatagcttatatgctgtctgac
agcagggcagcattactccttcaatctgaaaaaacagaaaaacggctattaggcattgaa
tgtgaacaaatcataatcgaagatattcaaaagcaaggagaggcgaagaacgttgaatct
tcagcagggccccattcacttgcatatatcatttatacctctggatcaaccggtaaacca
aagggtgtcatgattgagcagcgaagtgtaattcgtcttgttaaaaacagcaattatatt
acatttacacctgaagaccgccttctgatgacatcatcaatcggtttcgacgttgggtca
tttgaaattttcggaccgctgctaaatggtgccgctttgcatctgtccgatcaacaaaca
tttctcgattcccatcagcttaagaggtacatagaacatcaaggaatcacaacgatttgg
ctgacatcttctctattcaatcatttgacagagcaaaatgaacaaacattttcacagctg
aaacatttgattattggcggagaagctttgtcgccgagccacgtcaatcgaatcagaaat
gtctgccctgaagtatctatatggaatggatatggccctaccgaaaatacaactttttcg
acatgccttcacattcaaaaaacatatgaactttccattccgatcgggcggccggttggt
aattccaccgcttttatcttaaatcaatggggagtgctgcagccggtcggagctgtcggt
gaactttgtgtcggcggagatggcgtcgccagaggatatttgggccgtcctgatttaacg
aaagagaaatttgtcccacatccatttgcacctggcgatcgactgtatcgcacaggtgat
ctggcgcgctggctttccgatggcacaattgagtacgttggccgtattgatgatcaagta
aaagtcagaggctatcgggtggagctgggtgaaatcgaaacagcacttcgtcaaatagac
ggggtcaaagaagccgcagtgttagcacgtacagcccagaccgggagcaaagagctgttt
ggctatatcagcgtaaaagcaggcacgaatgctgaacaagtgcgttctcttctcgcgcgt
tcgctgccaaactatatgatcccggcgtatatcattgaaatggagactcttccgctcaca
tcaaacggcaaattgaaccggaaagcactgcctgaaccagatgtcgcatctaaacaaaca
tacatcccgccacgcaacgaacttgaagagcagctggcattgatctggcaggaggttcta
ggcatccagaggatcggaatagaggattcgttttttgaattgggcggagattcaatcaaa
gcccttcaagtttctgcacgccttgggcgctatggactaagcttgcaggtaagtgattta
ttccgtcatccaaagataaaggacttatcaccatttatccgtaagtcagagagaatcata
gagcaaggacccattcagggtgacgttccttggacgcctgttcagcaatggtttttttca
caagatattgaagaaagacaccatttcaatcagtctgtcatgctattccattctggacgt
ttgtctgaaaacgcccttagaccagccttgaaaaaactggcggagcatcatgatgcgctt
cggatggtttatcgcaacgatgacaggcgatggattcaaatcaaccaaggcattcatgag
tcacagctatacagcttaagaatctctgatctttcacagtcagaaagcggctgggagacg
aaaatcaaacaagaagttgccgatcttcagcaaagcatcaatttgcaggaaggaccattg
ttgcacgccgctttgtttaaaacactgaccggagattacttgttccttgcgatccatcac
cttgtcgttgatggtgtctcatggcggattttgctggaggatttgtcagccggatatcaa
caagctgctgcaggccagacgatccagcttccgcctaaaacggattcctaccaggaatac
gcaagacgcatacaggaatatgcccaaagcagtaagctgattcgcgaagaggcgtattgg
cgaagtgtagaagaacagcaagccgcagaactgccctatgaaataccgcatcatgtgaac
atcgacttcagcaaaagggactcattaagcttttcactgactgaagcagacaccgccgtc
ttgctgcaaaacgtcaatcacgcctatggcacagatacacaagatattctgttaaccgca
gcatccttggcgatttgtgaatggacaggaggaagcaagctccgtatcgctatggaagga
cacgggagagaacacattctgccagagttagatataagcaggacggtcggctggtttaca
tccatgtacccggccctcataagctttgaaaatcatagggatgagctcggaacctcagta
aaaaccgttaaagatacactgggccggataccaaacaaaggggtaggttacggtatgctg
aaataccttacacaccctgaaaataaaagcattacgttttcaaaaacacctgaaatcagc
tttaactatttgggccagttcaacgacatcgaaagacaggacaccttccgcccatcaagc
cttggtagcggaaaggatatcactcatacatggaagcgcgagcaaatcatcgagatgagt
gcaatggcagcagacaaaaagctccatttcaatcttagttatccgccagcccgctttcac
agaaacacaatggaacagcttattaacaggattgaacactttttgctggacattatgaaa
cactgcgccggtcaacagaaagcagaaaagacactgagcgatttcagcagtcaatcatta
acggcagaggacttggacagcatatccagcttggtggaagaattgtag

DBGET integrated database retrieval system