KEGG   Bacillus subtilis subsp. subtilis 168: BSU18330Help
Entry
BSU18330          CDS       T00010                                 

Gene name
ppsB
Definition
(RefSeq) plipastatin synthase subunit B
  KO
K15665  fengycin family lipopeptide synthetase B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BSU18330 (ppsB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU18330 (ppsB)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    BSU18330 (ppsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C BacteriocIIc_cy Transferase
Motif
Other DBs
NCBI-GeneID: 939993
NCBI-ProteinID: NP_389715
Pasteur: BG10971
BSORF: BG10971
UniProt: P39846
Position
complement(1982565..1990247)
Genome map
AA seq 2560 aa AA seqDB search
MAQSAQIQDIYPLSHMQEGMLFHSLMDFSSKAYIEQTSFTITGNLCVDSFQKSLNLLVSR
YDIFRTIFIKEVPDLTGPQQVVLSNRELTVYREDISRLADQEQQTLIDAFMTKDREKGFD
LQKDPLMRLALFDRGDSQYTCVWTHHHIIMDGWCLGIILKEFFSMYDSLKNNSPVQLGST
VPYSRYIEWLGEQDQEETAAYWSEYLKEYGNTASIPRIKRRTADGNYKADQVSFSLAPDM
VEKLTEAAQNWGVTLNTLFMSIWGVLLHRYNAADDAVFGSVISGRPSAIDGIESMVGLFI
NTVPVRIRSAEGITFSSLVKAVQEDILSSEQHGYYPLYEIQNHSPLKQGLIDHIFVFENY
PVQLHQALSVESENDEGALKLSDISMSEQTNYDFNIVIVPGESFYIKFSYNADVYEREEM
LRIQGHLKQALDCILTNPDVAVSDINIVPPEEQQVIQLFNETERPYVNKTIPQLFEEQAH
KTPEAAALKMGNECWTYRQLQVRANQIAHALIEKGVGSGDIVAVMMGRSMEMPAALLGIW
KAGGAYMPLDPHFPAERLSFLLKDSQAAQLLIEEDLISLIPPSYEGNTITIEHTESYQTE
APNMPPGDLAYLIYTSGTTGRPKGVLVDHHGIANTLQWRREEYSMTEQDISLHLFSYVFD
GCVTSLFTPLLSGACVLLTTDDEAKDVLALKRKIARYKVSHMIIVPSLYRVLLEVMTADD
AKSLRIVTFAGEAVTPDLLELNQIICPSAELANEYGPTENSVATTILRHLNKKERITIGH
PIRNTKVFVLHGNQMQPIGAAGELCISGAGLARGYYKQQELTQKAFSDHPFLEGERLYRT
GDAGRFLPDGTIEYIGRFDDQVKIRGYRIELREIETVLRQAPGVKEAAVLARDVSAEEKE
LVAYIVPEKGNSLPDLYQHLAGTLPSYMIPASIINISQMPLTSSGKLDRFALPEPENNTS
VTYMAPRTLIEADLAHIWEDVLNKQHIGIRDDFFQLGGQSLKAAALVSRIHKKLNVELPL
SEVFSYPTVESMAVKLMSLKEHAFTQIEPADQRDVYPLSFSQKRLYALHQLADDSTGYNM
PAVLELRGNLNRQRLRSVLTELVNRHEALRTVFVLDRDEPVQIIYPEMAFDLKELEMESE
QMLESAIETFIKPFYLSSGPLFRACVITMGNNRGFLLLDMHHIIADGVSMSTLVQEFTDL
YCGKELPALNLHYKDFAVWQQEKHPKELYKKQEAYWLGQLGGSLPTLELPLDKTRPRLPD
FRGGTIEVNIDKDMADELHRLMAETGTTLYMILLAVYSILLSKLSGQEDIVVGSPAAGRP
HADLERVIGMFVNTLAMRSKPEGHKTFSSYLHDIRHLALTAYEHQDYPFEELADKLDTNR
EVNRNPLFDAMLVLQSSEDFRFEVPGLSISSVTPKHDISKFDLTLHAEEHLSGIRCRFEY
STALFEEETITQWASYFIELVKGVTADTEMRISNMQLLPAAERRLLLEKMGQYAAYPRNE
NIVSLFEKQVAQYPEHIAVVCGHSQLTYRDLNEKAERAAAMLIKQGVRTGDIVGLMLDRS
PDMIIGVLSILKAGGAYLPIDPEYPKERISFMLNDSGAKLLLTERGLNKPADYTGHILYI
DECENNSIPADVNIEEIVTDQPAYVIYTSGTTGQPKGVIVEHRNVISLLKHQNLPFEFNH
EDVWTLFHSYCFDFSVWEMFGALLNGSTLVVVSKETARDPQAFRLLLKKERVTVLNQTPT
AFYGLMLEDQNHTDHLNIRYVIFGGEALQPGLLQSWNEKYPHTDLINMYGITETTVHVTF
KKLSAADIAKNKSNIGRPLSTLQAHVMDAHMNLQPTGVPGELYIGGEGVARGYLNRDELT
ADRFVSNPYLPGDRLYRTGDLAKRLSNGELEYLGRIDEQVKVRGHRIELGEIQAALLQYP
MIKEAAVITRADEQGQTAIYAYMVIKDQQAANISDIRTYLKNALPDFMLPARMIQIDSIP
VTVNGKLDQKALPEPEKQAYTADDISPRNEIETVMAEIWEELLNVDELGVSANFFKLGGD
SIKALQVCARLKQRGFETTVREMFEHQTLGELSARVRKDVRAIDQGPVEGEITWTPIQQW
FFSQSLESHHFNQSVMIYRAERFDEAALRKVLKSLVTHHDALRIVCRHEDGRQVQINRGI
DLSDEELYALELFDVKDSLTEARNTIEEAASRMQEHIRLETGPLLHAGLFRTENGDHLFL
TIHHLVVDAVSWRILFEDFSTAYKQAVSGESIKLPQKTDSYLTYSQRIADYSISRQVQRE
AAYWDECENRHIQPIPKDNDAASNTFKDTEVIDFELSRHHTELLLTAAHKAYSTEMNDIL
LTALGLALQKWTGNNQFKISMEGHGRESYLEDIDISRTVGWFTSIYPVWLDMRDSDHKDK
EERLGHLIKQTKDMLHRIPHKGAGYGVLKYISKRWGSQKNSPEISFNYLGQFDQDIQSNA
FEVSDIKPGNEISPNWERPYALDISGAVSSGCLNMHIIYNRFQFEEKTIQTFSRHFKQTL
ENIIEHCTGKENQEWSASDFTDEDLTLDELSEIMGAVNKL
NT seq 7683 nt NT seq  +upstreamnt  +downstreamnt
atggcacaatcggcacaaattcaagatatttatccgttatcgcacatgcaggaaggaatg
ctgtttcattcactaatggatttcagctcgaaagcatatatcgaacagacctcgtttacg
atcacagggaatctatgcgtcgactcgtttcaaaagagcttaaaccttcttgtttctaga
tatgatattttcagaacgattttcattaaagaagtaccagatcttacaggtccgcagcag
gtagttctatcaaaccgtgaattgacagtatatagagaagatatttctcgcctggctgat
caagaacagcagacgctgattgatgcttttatgactaaggatcgggaaaaaggatttgat
ttgcaaaaagatcctttaatgcgtcttgccctttttgatagaggagacagccaatataca
tgtgtctggacacatcaccatatcatcatggatgggtggtgtctcggcattattcttaaa
gagtttttcagcatgtatgattcgctcaaaaataactcacctgtacagcttggcagcacg
gtgccgtacagccgttatattgaatggctcggagaacaagatcaagaagagactgctgcc
tactggagcgaatatttgaaggagtacggcaatactgcttctattccccgaataaagcgc
cgcacggcagacgggaattataaagccgaccaggtcagcttttcattagcgccggatatg
gttgagaaactgacagaggctgcccaaaactggggagtgacattaaacacgctgtttatg
agtatttggggcgtgctgctccatcgatataatgctgcagatgatgccgtttttggctcc
gtcatttcgggacgcccgtcagcgattgacgggattgaatcaatggtcggtttgtttatc
aatactgttccagtgcgaatccgatctgcggaaggcataacattttcttcgctggtcaaa
gccgtgcaggaggatattttatcatctgaacagcatgggtattatccgctttatgagatt
caaaaccatagtccattgaagcaagggttgatcgatcatatttttgtttttgaaaattac
cctgtacagcttcatcaggcattaagcgtggagagtgaaaatgacgaaggcgctctgaag
ctgagtgacatttcaatgtcggaacaaaccaattacgactttaatatcgttatcgttccg
ggagaatcattttatatcaaattcagctacaacgcagacgtttacgagcgggaggagatg
ctgaggattcaggggcatctaaagcaagcactggattgcattttgacaaatcccgatgtt
gccgtcagtgacatcaatatcgtgccgccggaggagcaacaggttatccaattgtttaac
gaaactgagcgtccttatgtgaacaaaacgataccccaattgtttgaggaacaagctcac
aaaacacctgaagctgctgcattgaaaatgggaaacgagtgctggacctatcgccagtta
caagtaagagccaatcagattgcgcacgccctgatagaaaaaggcgttggatctggggat
atcgttgctgtaatgatgggccggtcaatggaaatgcctgcagctctgcttgggatttgg
aaagcaggcggcgcttatatgccgcttgatccacattttccagcagaacgtctttctttt
cttctgaaggacagtcaagcggctcaattgctgatagaagaagaccttatttccttgatc
cctccgtcctatgaaggaaatacgataacgatagaacatacagaaagttaccaaacagaa
gcgccaaatatgccgccaggtgatctagcctacttgatctatacgtcgggaacgacgggg
cgccctaaaggggttttagttgatcatcacggtattgccaatacattgcaatggagacgg
gaagagtatagcatgaccgaacaggatatatccctccatttgttttcgtacgtgtttgac
ggctgtgtaacgagcttatttaccccgcttttatctggtgcgtgcgtactgctgacaaca
gatgacgaagcgaaggatgtgctggcccttaagcgaaaaatagcccgttataaggtcagc
cacatgatcattgttccttccctgtacagggtgttattggaagtgatgactgctgacgat
gcaaaaagtcttcgtattgtgacatttgcgggtgaagcggtcacgcctgatctgcttgag
ttgaatcaaataatttgtccttctgctgaactggcaaatgaatacgggcccacagaaaac
agtgtggcaacaacaatattgcggcatctgaataaaaaagagaggatcacgatcggacac
ccgatcagaaacacaaaagtatttgttttgcacggaaatcaaatgcagccgatcggcgcg
gcgggtgaactgtgtatttccggcgcgggtcttgcgagaggatactacaaacagcaagag
ctgacacagaaagcattctccgatcatccattccttgaaggggagcgtttataccgaaca
ggtgatgcaggccgctttttgcctgatggaacgattgaatatattggacgttttgatgat
caagtgaaaattaggggttatcgtattgaactgagagagattgaaacagttcttcgacaa
gcaccgggggtaaaagaagcagcggtactggcccgtgatgtttctgctgaggaaaaggag
ctcgttgcttatatcgttccggaaaagggaaacagcctcccagatttgtatcagcatctt
gccgggacattgccgtcctatatgatcccagcaagtattatcaacatcagccagatgcca
ttaacatccagcggcaagcttgacaggtttgcgcttcctgaaccagaaaacaatacgagt
gtcacatatatggcgccccgaaccttaatcgaagctgatctcgcacatatttgggaagat
gtgctgaataaacagcacatcggcattcgtgatgatttctttcagttaggcggacagtcc
ttaaaagcggccgcactggtatcaagaatacataaaaagcttaatgtcgagctgccgctc
agtgaggtgttttcttatccgacggttgaaagcatggcggtcaaattgatgagcttaaaa
gaacacgcttttacacagattgaacctgcggatcaaagagatgtctatccgctgtctttc
tcgcaaaaacgattatatgctcttcatcagctggcagatgacagcacaggctacaacatg
ccagctgtacttgaattacgcggaaatctgaatcgccagcggttgagaagcgttctcaca
gaacttgtgaatcggcatgaagcattacggactgtttttgtgcttgacagagacgagcct
gtgcagatcatttatccagagatggcttttgatctaaaagagcttgaaatggaatcagaa
caaatgcttgagtctgcaatcgagacctttatcaaaccgttttatctatcatccggtccg
ctttttagagcatgtgtcattacaatgggcaataatcgcggctttttgctgctcgatatg
caccatattattgccgacggtgtctcgatgagcactcttgtccaagaatttactgactta
tattgcggaaaagagttgccagctttaaacctgcattataaggattttgctgtttggcag
caagagaagcacccgaaagagctatacaaaaaacaggaggcctactggctcggtcagctt
ggcgggagtcttcctacactagaattaccgcttgataaaacaaggccgcgtctccctgat
ttcaggggtggaacaattgaagtcaacattgataaagacatggctgatgaactgcaccgt
ttaatggctgaaacgggaacaacattgtatatgattcttctggctgtctattctattttg
ttatctaagctaagcgggcaagaggatattgttgtcggttcgcctgctgccggaagaccg
cacgctgatctggagcgcgtcatcggaatgttcgtcaatacattggcgatgcgcagcaag
cccgagggccacaaaacgttcagctcctatttgcatgacattcgccacctggctctgacc
gcttacgagcatcaggattatccttttgaggagctggcagataagctcgatacaaatcga
gaggtaaatcgcaacccgctgttcgatgcgatgcttgtgcttcaaagcagtgaagatttc
cggttcgaagtgcctggtctgtcgatttcgtctgtcactcctaaacatgatatatctaaa
ttcgatttaacattacatgctgaggagcatctgagtggaatacgctgccgttttgaatac
agcactgctctttttgaagaagaaaccattacgcagtgggcatcctattttattgaattg
gtaaaaggggtaacggcggatactgagatgagaatttcgaacatgcaattgcttcctgct
gcagagcgtaggttactccttgaaaaaatggggcagtatgcagcttatccgagaaatgaa
aacatagtaagcttatttgaaaagcaagtagctcagtatccggagcatatcgcagtggtg
tgcggccattctcagcttacgtatcgagacctgaatgaaaaagccgagcgggcagctgct
atgctgatcaaacaaggggtcagaactggcgatatcgtcggtctgatgctcgatcggtca
cctgatatgatcattggcgttttatcgattttaaaagctggcggggcctatttgccgatt
gatcctgaatatcccaaggagcgtattagctttatgctcaatgacagcggagcaaaactg
ctgctgacagagcgcggtctaaacaaacctgcagactacaccgggcatattttgtatatc
gatgaatgtgaaaacaactcaattccggctgatgtaaacattgaagaaatagtaacggat
cagcccgcatacgtgatatacacatctggaacgactggtcagccaaagggagtcattgtc
gagcaccgcaatgtgatcagtctcttgaagcatcaaaacctgccttttgaatttaaccat
gaagacgtctggacgttatttcattcttattgctttgatttctctgtatgggagatgttc
ggtgcgttattgaacggaagtacattagtcgtggtctctaaagaaacagcccgtgacccc
caagcattccgattattgttaaaaaaagagcgcgtcactgtactcaatcagaccccgact
gctttttacggcttgatgcttgaagaccaaaatcatacagatcatttaaacatccgctat
gtgatttttggcggcgaagccttacagcccggattgcttcaaagctggaatgaaaaatat
cctcatactgatttgattaatatgtacggtattacagaaacaacggtccatgtaacattc
aaaaaattgtccgcagcagacattgcaaaaaataaaagcaatatcggccggcctctttct
actctgcaggctcatgtgatggatgcccatatgaacctgcagccgaccggagttccaggg
gagctgtatataggcggcgaaggtgtggcacggggatatctcaacagagatgagctgacc
gctgaccgttttgtatccaatccttatcttccgggagacagattataccgaacaggagat
cttgctaagcgcctgtcaaatggcgagctggaatacttaggccgcattgatgagcaggtg
aaagtcagagggcaccgtattgagttaggcgaaatccaagcggcacttcttcagtatcca
atgattaaagaggcggctgtcattaccagagcagacgagcaagggcaaacagctatatat
gcatatatggtgataaaagatcaacaggctgcgaatatatcagacatccgaacttaccta
aaaaacgccttgcctgactttatgctgcctgcccgtatgatacaaattgacagcatcccg
gtgactgttaatggaaagctcgatcagaaagccctgccagagcctgaaaaacaagcttat
acagctgatgatatcagtcctagaaatgagattgaaacggtgatggctgaaatttgggaa
gagcttcttaatgtagatgagctgggtgtaagcgccaatttctttaagcttggcggagac
tctattaaagcgctgcaggtttgtgccagactgaagcagcgcggatttgaaacgacagta
cgtgagatgtttgaacatcagactcttggtgaactgtccgcccgggttcgaaaagacgta
cgcgccattgaccaaggcccggtcgaaggcgagattacttggacacctatccagcagtgg
tttttctcgcaatctctggaaagccatcattttaaccaatccgttatgatctaccgggct
gaacgatttgatgaggctgcgcttagaaaagtactaaaaagccttgtgactcatcatgat
gcactgagaatcgtatgccggcatgaagatggcaggcaagtgcagataaacagagggata
gatctttcagatgaggagctatatgcacttgaactgtttgatgtaaaggatagcctaaca
gaagcccggaacacgattgaggaagcagccagccggatgcaagaacatattcgtttggaa
accggccccttacttcacgctggattgtttagaaccgagaatggtgaccatttatttcta
acgattcatcacttagttgttgatgcggtttcttggcgcattttgtttgaggatttttca
acagcttacaaacaggcagtctcaggagaatctattaaactgccgcaaaaaacagattca
tatttaacgtattcacaaagaatagctgactactctataagccgccaggtgcagcgcgaa
gcagcgtactgggatgagtgcgagaaccgtcacatccagcctattccaaaagacaatgac
gcagcatctaacacattcaaagatacagaagtgattgattttgagctatctcgccatcac
acagaattactattaacggctgcacataaagcttacagcacggagatgaatgatatcctt
ctgacagctttaggtcttgctttgcagaaatggacgggaaataaccaatttaaaatcagc
atggagggccatggaagggaatcatatcttgaggacatcgatattagcagaactgttggc
tggttcacctccatttatcctgtgtggcttgatatgagagattccgatcataaggacaaa
gaagagcggctgggccaccttattaaacagacaaaagatatgctgcaccgtataccgcat
aaaggcgcgggctacggcgtgctgaaatatatcagcaaaagatggggctctcagaaaaac
agcccagaaatcagctttaattatttaggccagtttgatcaggatattcaatcaaatgcc
tttgaggtgtctgacatcaagccaggaaatgagatcagcccgaactgggagcgtccttat
gcactggatatcagcggcgccgtttcttcggggtgcctgaacatgcacatcatctataac
aggtttcaatttgaggaaaaaacaatccaaacattttccaggcattttaaacagactctg
gaaaacatcattgagcattgtaccggcaaagaaaaccaagagtggagcgcatctgatttc
actgatgaagacttaacgcttgatgaattgagtgagatcatgggagccgtcaacaaacta
tag

DBGET integrated database retrieval system