KEGG   Bacillus subtilis subsp. subtilis 168: BSU18360Help
Entry
BSU18360          CDS       T00010                                 

Gene name
yoxA
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00052  Galactose metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Module
bsu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU18360 (yoxA)
   00052 Galactose metabolism
    BSU18360 (yoxA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BSU18360 (yoxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF5107 DUF4432
Motif
Other DBs
NCBI-GeneID: 938046
NCBI-ProteinID: NP_389718
Pasteur: BG10253
BSORF: BG10253
UniProt: P39840 C7C5G7
Structure
PDB: 

Position
complement(1999849..2000826)
Genome map
AA seq 325 aa AA seqDB search
MANFIEKITYLGTPAIKAGNEHLEMIVVPEWGSNVISLVDKTTNVQLLREPETAESFHDT
PTLYGIPILFPPNRISDGTFSFRGRTYHFDINEKDKHNHLHGFLYHEKWNVVTTKQTDEG
VIVETEIDLSELPHVQKQFPHHAVVRMTYTIKENTLFKHATVMNKGKEAFPWGIGYHTTF
IFPAESSLFSLTADQQWELDERLLPTGKLMDVPYKEALHEGMDLRHKQLDDVFLSSYQKR
GGENQAVIYHQHAHISIIYKADEQFKHWVVYNADGKQGYLCPEPYTWVTNAVNLDLPSSL
TGLQVLEPGEETTAKSSITIELNHQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactttattgagaaaatcacgtatttgggaacgccggccatcaaagcgggcaac
gaacatctagaaatgattgttgtccctgagtgggggagcaacgtcatttctctcgtggac
aaaacaacaaatgtccagcttttgcgtgaaccggaaacagcagaaagttttcacgacaca
ccaacattgtatggcattccaatcctgttcccgcctaaccgcataagtgacggtacattc
agtttccggggcagaacgtatcattttgatatcaacgagaaggataaacacaaccatctt
cacgggtttctttaccatgaaaagtggaatgtcgtgaccacgaagcaaactgatgaagga
gtgattgttgaaacagaaattgatctttctgagcttccccatgtgcagaagcaatttcct
catcatgccgtcgttcggatgacatacacgatcaaggagaataccctatttaaacatgcg
acggtcatgaacaaaggaaaggaagcgtttccttggggaattggttatcatactacattt
atatttccggcagaaagctcgttattctccctgacagcagatcagcaatgggagttggat
gaacgcctgctgccgaccgggaagctgatggatgtcccgtataaagaagctttgcatgaa
ggaatggatttgcgccacaagcagctggatgatgtctttttatcttcttatcagaagagg
ggcggagaaaaccaggcagtcatttatcatcagcatgcacatatcagcattatttataag
gcagatgaacagtttaaacattgggttgtatacaatgcggacggaaaacaagggtattta
tgccctgagccttacacatgggtgacaaacgcagtgaatcttgatttaccttcgtcactc
actggtttacaagtgctggagccgggagaagaaacgacagctaaaagcagtatcaccatt
gaactgaatcatcaatag

DBGET integrated database retrieval system