KEGG   Bacillus subtilis subsp. subtilis 168: BSU18370Help
Entry
BSU18370          CDS       T00010                                 

Gene name
yoeA
Definition
(RefSeq) multidrug resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE Polysacc_synt_C DUF3742
Motif
Other DBs
NCBI-GeneID: 939596
NCBI-ProteinID: NP_389719
Pasteur: BG13548
BSORF: BG13548
UniProt: O34474
Position
complement(2000960..2002351)
Genome map
AA seq 463 aa AA seqDB search
METSQEPLVTQKKSKPSVWRSMSLFLVPLLLSNVLQSVGQLVGMMAVGRWLGVDAVAAVS
SFFPLFFLLISFTIGIGSGSSILIGQAYGAKNEERLKAVVGTTLTFTFLLGVVLAVIGSI
FTLDILRLMGTPENVIHVSANYARILFYAMPFMFLYFAYTTFLRGTGDSKTPFYTLIVST
VINIALLPVLILGMFGFPKLGIYGSAYATVISTIATFLVLMVYLRKRKHPLQFDKTVRRY
LKMDKELLVLLLRLGVPASINMILVSLSEIAVISFVNHYGSNATAAYGVVNQVASYVQMP
AVSLGIAVSIFAAQSIGANEFDRLKQVIRVGIWLNYIIGGVLIILIYVFSHQILSLFLTE
QETLYIAHRLLMITLWSYLLFGNAQIISATMRASGTVLWPTVISIFAIWGVEVPVAFVLS
HYTKLEILGVWVGYPAAFAVSLLLIYGYYQFVWKKKQITRLIQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatcacaagaacctcttgtaactcaaaagaaaagcaaaccatcagtttggcgg
tcgatgtcactctttttagtgccgcttctgctgagcaatgtgctgcaatcagtcggccag
ctagtcgggatgatggctgtaggcagatggctcggtgttgatgcagtggcagctgtatca
tcctttttcccgttattttttcttttaatctcatttacgattgggatcggttcaggaagt
tcgattctgataggacaagcttacggagcgaaaaatgaggaacggctaaaggctgttgtc
gggacgacactcacgtttacatttttattaggcgttgtgttagccgttatcggcagtatt
ttcaccctggatatccttcgtttaatgggaacacctgaaaatgtcattcatgtcagcgct
aactatgcacgtattttattttatgctatgccgtttatgtttttatattttgcatatact
acctttttgcgcggaacaggagattccaagacaccgttttatacgctgattgtgagcacg
gtcatcaacatcgcgcttttgcctgttttaatccttggcatgtttggttttccgaaactg
ggcatatacggctcggcatatgcaactgtcatttccacgattgcgacttttctcgtgtta
atggtgtatttacgaaagcgaaaacacccgctgcaatttgataaaacagtgcgtcgttat
ttgaaaatggataaggaactgctggttctcctgctgcgtcttggggtcccagcaagcatc
aatatgattcttgtctcattatcagagatagcggttatttcattcgtcaatcattacggc
tctaatgcaacagctgcatacggagtggtcaaccaggtggccagctatgtacagatgccg
gccgtcagccttggtattgcggtttctattttcgctgcgcaatcgatcggagcaaacgag
tttgaccgcttaaagcaggtcattcgcgttgggatttggctgaattatatcattggcggc
gtactgatcattctgatctatgttttttcacatcagattttatcgttatttttaaccgag
caagagacgctttacattgcgcaccgtcttttgatgattacactgtggagctatttgctg
tttggaaatgcccaaattatttctgcaacgatgcgggcaagcggaacagttttatggccg
accgtcatcagtatttttgcaatctggggagtagaggtgcctgtcgctttcgtcctttct
cactatacaaagcttgaaatactcggcgtctgggttggttatccagctgcgtttgccgtc
agcttgctgttgatttatgggtattatcaattcgtctggaaaaagaaacaaatcacacgt
ctcatccaatag

DBGET integrated database retrieval system