KEGG   Bacillus subtilis subsp. subtilis 168: BSU18380Help
Entry
BSU18380          CDS       T00010                                 

Gene name
iseA
Definition
(RefSeq) hypothetical protein
  KO
K23598  iseA protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU18380 (iseA)
Peptidases and inhibitors [BR:bsu01002]
 Peptidase inhibitors
  Family I80
   BSU18380 (iseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Endopep_inhib Pox_vIL-18BP MecA_N
Motif
Other DBs
NCBI-GeneID: 939964
NCBI-ProteinID: NP_389720
Pasteur: BG13549
BSORF: BG13549
UniProt: O34841
Structure
PDB: 

Position
2002637..2003182
Genome map
AA seq 181 aa AA seqDB search
MKKCLLFLTTIALILSLSTNAFAKNTSGDLSQKQALQLALSAREHFWNTMSGHNPKVKKA
VCPSGTFEYQNLQYVYMCSDLGTKAKAVNYLTPIFTKTAIEKGFKDYHFTVSKGKLAVPI
GDGDNLLNWKKSTAKLISKKGSTITYEFTVPTLDGSPSAKRKVTFVKENKKWKVNQFDAV
I
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatgtcttctatttctaacaaccattgcacttattctgtcattaagcacaaat
gcatttgcgaaaaatacatcaggcgatttatcacaaaaacaagcattacagttggcatta
tccgctagagaacatttttggaacaccatgagcggccacaatccgaaggtgaaaaaagca
gtttgcccatcaggcacattcgagtatcaaaatcttcaatatgtatacatgtgcagtgat
ctaggcactaaagcaaaagcggtgaattatttaactcctatttttacaaaaacagcaatc
gaaaaaggctttaaagattatcatttcactgtttcaaaaggaaaacttgctgttccaatc
ggtgacggagacaatcttttgaattggaaaaaatcaactgctaaactgatctctaaaaaa
ggcagcacaatcacatacgaatttactgtccctacattagacggatccccttctgcaaaa
cggaaagtgacatttgtgaaagaaaataaaaaatggaaagtcaatcaatttgacgcagtt
atataa

DBGET integrated database retrieval system