KEGG   Bacillus subtilis subsp. subtilis 168: BSU18390Help
Entry
BSU18390          CDS       T00010                                 

Gene name
yoeC
Definition
(RefSeq) integrase/recombinase YoeC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase
Motif
Other DBs
NCBI-GeneID: 939595
NCBI-ProteinID: NP_389721
Pasteur: BG13550
BSORF: BG13550
UniProt: O35009
Position
complement(2003401..2003946)
Genome map
AA seq 181 aa AA seqDB search
MHIVQPIRSLEKIQEVKQYLLNKNKRDYFLFIFGINSALRISDILPLQVKDVQNKDHLWA
TESKTKKKRKILILESLKQEIYEYTKDMKENEYLFKSVRTRKPISRIQAYRILREAAAAC
GLEEIGTHTLRKTFGYHFYQRTKDIAELQRILNHSSPSITMRYIGIDEDTTRAAYKVFGG
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgtacagccgattcgcagtctagagaaaatccaagaagtcaaacagtatttg
cttaacaaaaacaagcgggattattttctgtttattttcggcatcaacagcgcgctccgt
atttctgatattctgccgctgcaagtgaaggacgttcaaaataaagatcatttatgggcg
actgaaagcaaaacgaaaaagaaaagaaagattcttattttagaatcgctgaaacaggaa
atatacgagtatacgaaagacatgaaggaaaacgaatatctttttaaatcagtgcggacc
aggaagccgatttcccgcattcaggcctacagaattttaagagaggccgctgcagcgtgc
ggacttgaggagatagggacgcatacactccggaaaacgtttggctatcatttttatcag
cgaacgaaagacatcgccgagctgcagagaatactgaatcattcatcaccatcaattaca
atgcggtatatcggtattgatgaagatacgacaagagccgcatataaggtttttggaggg
ctttaa

DBGET integrated database retrieval system