KEGG   Bacillus subtilis subsp. subtilis 168: BSU18410Help
Entry
BSU18410          CDS       T00010                                 

Gene name
ggt
Definition
(RefSeq) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00430  Taurine and hypotaurine metabolism
bsu00460  Cyanoamino acid metabolism
bsu00480  Glutathione metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSU18410 (ggt)
   00460 Cyanoamino acid metabolism
    BSU18410 (ggt)
   00480 Glutathione metabolism
    BSU18410 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU18410 (ggt)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BSU18410 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BSU18410 (ggt)
Peptidases and inhibitors [BR:bsu01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BSU18410 (ggt)
CD molecules [BR:bsu04090]
 Proteins
  BSU18410 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 940001
NCBI-ProteinID: NP_389723
Pasteur: BG11838
BSORF: BG11838
UniProt: P54422
Structure
PDB: 

Position
2004677..2006440
Genome map
AA seq 587 aa AA seqDB search
MKRTWNVCLTALLSVLLVAGSVPFHAEAKKPPKSYDEYKQVDVGKDGMVATAHPLASEIG
ADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGA
TPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKG
FPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAF
YKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQ
MLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKE
RQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQPKDKVEGQTTHFTVADRWGNVVSYTT
TIEQLFGTGIMVPDYGVILNNELTDFDAIPGGANEVQPNKRPLSSMTPTILFKDDKPVLT
VGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSMSSYRYEDGVPKDVLSKLNG
MGHKFGTSPVDIGNVQSISIDHENGTFKGVADSSRNGAAIGINLKRK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacgtggaacgtctgtttaacagctctgcttagtgttctgttagtcgctgga
agtgtcccttttcacgcggaagctaaaaaaccgcccaaaagctacgatgagtacaaacaa
gtagatgttggaaaagacggcatggttgcgaccgcacatcctcttgcttctgaaatcggt
gctgatgtgctgaaaaaaggaggaaatgctattgacgcagcggttgccattcaatttgca
ctcaatgtaacagagccgatgatgtcaggtattggcggcggcggttttatgatggtgtat
gacggaaaaacgaaggatacaacgataatcgacagccgtgagcgtgctccagcaggcgca
actcctgatatgtttctggacgaaaacggcaaagcaattcctttctctgaacgtgtaaca
aaaggtactgccgttggtgttccaggcactctgaaagggctggaagaagccttggataaa
tggggaacccgttcgatgaagcaattaattaccccttctattaaactcgctgaaaaaggc
tttccgattgattcggtgttggcagaggccatttctgattatcaggaaaagctttcacgg
actgccgcaaaagatgtatttttaccaaatggcgaaccgcttaaagaaggagataccctt
attcaaaaggatttggctaaaacatttaagcttattcgctccaaaggcactgacgctttt
tataaaggaaaattcgccaagacgctttctgacactgtccaggatttcggcggatcaatg
acagaaaaagatttagaaaattacgacattacaattgatgaaccgatttggggagattat
caaggctatcaaatcgctactactcctcctccaagctccggcggtattttcttattgcaa
atgctgaaaatccttgatcattttaacctttcacaatacgatgtccgctcatgggaaaaa
tatcagctgcttgctgaaacgatgcatttgtcatatgccgaccgtgcgtcttacgcaggt
gatcccgaatttgtaaatgttcctctcaaaggcctgcttcaccccgattatattaaagaa
cgccagcaattaatcaacctagatcaagtgaataaaaaaccgaaagccggtgacccttgg
aaataccaagaaggatcagcaaactataaacaagttgaacagccgaaagacaaagtagaa
ggccaaacaacccactttacagttgctgaccgttggggaaatgttgtttcttatacaaca
acaatcgaacagctattcggaacgggtattatggtccctgattacggtgttattttaaac
aatgaattaacggattttgatgcgataccaggcggagctaacgaagtacagccaaacaaa
cggcctttaagcagcatgaccccgacgattttatttaaggatgacaagcctgtcctcacg
gttggatctcctggcggggccacaattatttcatccgttttgcaaaccattctctaccac
attgaatatggtatggaattaaaagcagctgttgaagagccgagaatttacacaaacagc
atgagctcttaccgttacgaagacggagttcctaaagatgtcctcagcaagctaaacggc
atgggccacaaattcggcacaagtccggtggatatcggaaacgtgcaaagtatatcgatc
gaccatgaaaacggcacctttaaaggtgtagctgattcaagcagaaacggcgcggcgatc
ggcattaatttaaaacgtaaataa

DBGET integrated database retrieval system