KEGG   Bacillus subtilis subsp. subtilis 168: BSU18420Help
Entry
BSU18420          CDS       T00010                                 

Gene name
ftsR
Definition
(RefSeq) LysR family transcriptional regulator
  KO
K21959  LysR family transcriptional regulator, cell division regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU18420 (ftsR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    BSU18420 (ftsR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-GeneID: 940018
NCBI-ProteinID: NP_389724
Pasteur: BG13552
BSORF: BG13552
UniProt: O34685
Position
complement(2006541..2007398)
Genome map
AA seq 285 aa AA seqDB search
MESGDLKIFQAVAREGSITKAAQMLNYVQSNVTARVHNLEEDLNIRLFHRTNRGMKLTAA
GENLLQYADQVLSLLDQAEKSTRMSRQPKGPLRIGSLETMAVTHLPEHAASFLRRFPEVD
LSVNTADTHHLIQQVLDHKVDGAFVYGPVEHAAVRQLHVSHDELVLISSREGTAEDMLQQ
PMLFFGAGCSHRDRVKRLLEEAGIHNQKIIEFGTLEAIIKGVSAGMGTALLPKSAVDGSE
HRTNVWIHQLPPSYQDLEIVFIYRKDFFITSAFQTFLDEINEMKR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtggaaagcggagatttaaagatttttcaggctgttgctcgcgaaggaagcataacgaaa
gcagcccaaatgctgaattatgttcagtcgaatgtgacagccagagtgcataaccttgag
gaagatttgaatatcaggctttttcatcgaacgaatcggggaatgaagctgactgctgca
ggagaaaatcttttacaatatgcagatcaagtattatcgctgttagaccaagctgaaaaa
tcgacccgaatgagcaggcaaccaaaagggcctttgcggatcggatcactggaaacaatg
gcggtaacgcatctgcctgagcatgcagcatccttcctcaggcgttttcctgaagtggat
ttatcagtgaacacagctgatacgcatcatttgattcaacaggttcttgatcataaagtt
gatggcgcttttgtatatgggccggttgaacacgctgcagttagacaactccatgtctcc
catgatgaattagttttgatttcatcacgagaagggacggcagaagacatgcttcagcag
ccgatgctcttttttggggctggctgttctcatcgtgacagggtcaaaagattactagag
gaagcaggcatacacaatcaaaaaatcatagagtttggcacattggaggctattataaaa
ggtgtttccgccgggatgggtacggcgctgctcccaaagtccgctgttgacggctccgag
catcgtacaaatgtatggattcatcagctgccaccatcatatcaagacttagagatcgtc
tttatatacaggaaagacttttttattacgagtgcgtttcagacatttcttgatgagata
aacgaaatgaaaagatga

DBGET integrated database retrieval system