KEGG   Bacillus subtilis subsp. subtilis 168: BSU18430Help
Entry
BSU18430          CDS       T00010                                 

Gene name
yogA
Definition
(RefSeq) zinc-type alcohol dehydrogenase
  KO
K13955  zinc-binding alcohol dehydrogenase/oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BSU18430 (yogA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 940019
NCBI-ProteinID: NP_389725
Pasteur: BG13553
BSORF: BG13553
UniProt: O35017
Position
2007526..2008515
Genome map
AA seq 329 aa AA seqDB search
MKAVIHNGKAGLLGLSVQDVPSTKPGYGEVKVKLKSAGLNHRDLFLMKNKSEQDPHMILG
SDGAGIIEEIGEGVKNVTVQTEVVIFPTLNWDLTENVPPVPEILGGPSDGTLAEYVIIPS
QNAIKKPAYLSWEEAGVLPLSALTAYRALFTKGQLKKGEHLLIPGIGSGVATYALFMAKA
IGATVSVTSRSEEKRKKALKLGADYAFDSYSNWDEQLQGKKIDVVLDSIGPALFSEYFRH
VKPNGRIVSFGASSGDNLSFPVRSLFFPQVNVLGTSMGSGEEFQAMLAFIDKHKLRPVID
RIYPLEKACEAYKRMQEGRQFGNIGIVME
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtaattcacaacggaaaagccggtcttctggggttatcagttcaggacgtt
ccatcaacaaagcctggatacggagaggtaaaggttaaattaaaatctgcaggcctgaat
catcgtgacttgtttcttatgaaaaacaaatctgaacaagatcctcacatgatactgggt
tctgacggcgcgggtatcatcgaagagattggtgaaggcgtgaaaaatgttactgttcag
acagaagtagtcattttcccgacattgaactgggatttgacagaaaatgttccacctgta
cctgagattctgggaggtccttcggacggaacacttgctgaatatgtgatcattccttca
caaaatgcaatcaaaaaacctgcttatttatcttgggaagaagcgggcgttttaccttta
tccgctttaactgcatatcgggctctgtttacaaaggggcaattaaaaaaaggcgagcat
ctattgatacccggcatcggcagcggtgtagcaacctacgctttatttatggctaaggcg
attggggcaacagtaagcgtgacctcccgcagtgaggagaaaagaaaaaaggcgctgaaa
ttaggtgctgattacgcatttgacagctacagcaattgggatgagcagttgcagggaaaa
aagatagatgttgttcttgacagcataggacctgccctcttttcggaatacttccgccat
gtaaaaccaaatggccgtattgtcagctttggggcaagctcaggggataatctcagtttt
ccggtgcgttctttattctttcctcaggtcaatgttttgggaacctcgatgggaagcggt
gaggaatttcaagctatgctcgctttcattgacaaacataagctgcggcctgtaattgac
cggatatatcctttagaaaaagcatgtgaagcatataaaagaatgcaggaaggcagacag
tttggaaacatcgggatcgtaatggaataa

DBGET integrated database retrieval system