KEGG   Bacillus subtilis subsp. subtilis 168: BSU18440
Entry
BSU18440          CDS       T00010                                 

Symbol
gltD
Name
(RefSeq) glutamate synthase [NADPH] small chain
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU18440 (gltD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU18440 (gltD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     BSU18440 (gltD)
SSDB
Motif
Pfam: Pyr_redox_2 Fer4_20 Pyr_redox_3 Pyr_redox NAD_binding_8 DAO Amino_oxidase NAD_binding_7 HI0933_like FMO-like FAD_oxidored FAD_binding_3 NAD_binding_9 FAD_binding_2 Thi4 AlaDh_PNT_C K_oxygenase GIDA 2-Hacid_dh_C Lycopene_cycl ApbA NAD_Gly3P_dh_N IlvN DUF3343 3HCDH_N
Other DBs
NCBI-GeneID: 940053
NCBI-ProteinID: NP_389726
Pasteur: BG12594
BSORF: BG12594
UniProt: O34399 A0A6M4JGY1
Position
complement(2008572..2010053)
AA seq 493 aa
MGKPTGFMEIKREKPAERDPLTRLKDWKEYSAPFSEEASKRQGARCMDCGTPFCQIGADI
NGFTSGCPIYNLIPEWNDLVYRGRWKEALERLLKTNNFPEFTGRVCPAPCEGSCTLAISD
PAVSIKNIERTIIDKGFENGWIQPRIPKKRTGKKVAIVGSGPAGLASADQLNQAGHSVTV
FERADRAGGLLTYGIPNMKLEKGIVERRIKLLTQEGIDFVTNTEIGVDITADELKEQFDA
VILCTGAQKQRDLLIEGRDSKGVHYAMDYLTLATKSYLDSNFKDKQFIDAKGKDVIVIGG
GDTGADCVATALRQKAKSVHQFGKHPKLPPARTNDNMWPEQPHVFTLEYAYEEAEAKFGR
DPREYSIQTTKMVADKNGKLKELHTIQMEKVKNEHGKYEFRELPGTEKVWPAQLVFIAIG
FEGTEQPLLKQFGVNSVNNKISAAYGDYQTNIDGVFAAGDARRGQSLIVWAINEGREVAR
EVDRYLMGSSVLP
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggggaaaccaactggatttatggagatcaaacgagaaaaacctgcggagcgggaccct
ctcactcgcttaaaggattggaaagaatattctgctcctttttcagaagaagcatcgaaa
cggcaaggggcgcggtgtatggattgcggtacaccgttttgccagatcggtgcggacatt
aacggatttacatccggctgtccgatttacaacttaattcctgaatggaatgatcttgtc
taccggggcagatggaaggaagcattggaacgtctgttgaaaacaaacaactttcctgaa
ttcacagggcgggtatgccccgctccttgtgaaggatcatgcactttagcgatttcagat
ccggccgtatcaattaaaaacatcgagcggaccattatcgataaaggatttgagaacggc
tggattcaacctagaattccaaaaaaacgaacaggcaaaaaagtggccatcgtcgggtca
ggcccagccggactggcgagtgctgaccagctgaatcaagcgggacattccgtcactgtt
tttgaacgagcagacagagcgggcggccttttaacatacggcattccaaacatgaagctt
gagaagggcattgtagaacgccgaattaaattgctgacgcaagagggaattgattttgtc
acgaacacagaaatcggtgttgacattacagctgatgagctaaaggagcaatttgatgct
gtgatcttatgcacaggcgctcaaaaacagcgggacctcttaatcgaaggacgcgactca
aaaggagtccattacgcaatggactacctcacacttgcaacaaaaagctatttagattct
aattttaaagacaagcaattcattgatgccaaagggaaagatgtcatcgtaatcggaggc
ggagatacaggagctgactgtgtggctaccgctctgcgtcaaaaagccaaaagcgtgcac
caattcggcaaacacccgaaacttccgccagcccgcacgaatgacaatatgtggcctgaa
cagccacacgtctttacgcttgaatatgcatacgaggaagcagaagcaaaattcggaaga
gatccgagagaatactccattcaaacgacaaaaatggtcgcggataaaaacggaaagctg
aaagagcttcataccatccaaatggaaaaagtgaaaaatgagcatggaaaatacgagttc
cgcgagctgcctggaacggaaaaagtatggcctgctcagcttgtctttatcgctatcggc
tttgaaggcacagaacagccgctgttgaaacagttcggtgttaattcagtaaataacaaa
atcagtgcagcatatggggattatcaaacaaatatcgatggtgtattcgccgcaggggat
gcaagaagagggcaaagcttaatcgtatgggcgattaatgaaggccgtgaagtggcgcgt
gaagtggatcgatatttgatggggagttcagttcttccgtaa

DBGET integrated database retrieval system