KEGG   Bacillus subtilis subsp. subtilis 168: BSU18460
Entry
BSU18460          CDS       T00010                                 

Gene name
gltC
Definition
(RefSeq) LysR family transcriptional regulator
  KO
K09681  LysR family transcriptional regulator, transcription activator of glutamate synthase operon
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU18460 (gltC)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    BSU18460 (gltC)
SSDB
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_5
Other DBs
NCBI-GeneID: 940104
NCBI-ProteinID: NP_389728
Pasteur: BG10810
BSORF: BG10810
UniProt: P20668 A0A6M3ZEV4
Position
2014779..2015681
AA seq 300 aa
MELRQLRYFMEVAEREHVSEAADHLHVAQSAISRQIANLEEELNVTLFEREGRNIKLTPI
GKEFLIHVKTAMKAIDYAKEQIDEYLDPHRGTVKIGFPTSLASQLLPTVISAFKEEYPHV
EFLLRQGSYKFLIEAVRNRDIDLALLGPVPTNFSDITGKILFTEKIYALVPLNHPLAKQK
TVHLIDLRNDQFVLFPEGFVLREMAIDTCKQAGFAPLVSTEGEDLDAIKGLVSAGMGVTL
LPESTFAETTPRFTVKIPIEFPQVKRTVGIIKPKNRELAPSANDFYEFVIQFFSKLEQYQ
NT seq 903 nt   +upstreamnt  +downstreamnt
atggagctgcgccaactgcgttattttatggaggtggctgaaagagaacacgtttcagaa
gccgctgatcatttgcatgtggcccaatcagcaatcagcagacaaattgccaatcttgaa
gaagaattaaatgtgaccttatttgagcgtgaagggagaaatatcaaactcacgccaatc
ggaaaagaatttttaattcatgtgaaaacggcgatgaaagccattgattatgcgaaagag
caaattgatgagtatcttgacccgcatcgcggaacggtaaagatcggctttcctacaagc
ctcgccagccagcttttgccgactgtcatttcagcgtttaaagaagaatatccgcacgtc
gaatttttgctgcgccaaggctcctataagtttctgattgaagctgtcagaaaccgcgat
attgatctggccttattagggccggtgccgacgaatttctctgacataacgggaaaaata
ttatttactgaaaaaatttacgcgcttgttccattaaatcatccgcttgctaaacaaaaa
acggttcatttaatcgatttgcgcaacgaccaatttgtattgttcccggaaggatttgta
cttagagagatggcaatcgatacttgcaaacaagcaggctttgctcctctcgtttccacg
gagggtgaggatttggatgcgatcaaagggttagtgtccgcaggaatgggcgttaccctt
ctgcctgaaagtacttttgctgaaacaacacctcgttttactgtgaaaattccaattgag
ttccctcaagtaaaacggactgtcggaatcattaaaccgaaaaatagagagcttgcgcct
tccgcgaatgatttttatgagtttgtcattcaatttttctctaagctggagcagtatcaa
taa

DBGET integrated database retrieval system