KEGG   Bacillus subtilis subsp. subtilis 168: BSU18490Help
Entry
BSU18490          CDS       T00010                                 

Gene name
rtp
Definition
(RefSeq) replication termination protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RTP PadR Stk19
Motif
Other DBs
NCBI-GeneID: 940068
NCBI-ProteinID: NP_389731
Pasteur: BG10738
BSORF: BG10738
UniProt: P0CI76
Structure
PDB: 

Position
complement(2017886..2018254)
Genome map
AA seq 122 aa AA seqDB search
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRS
LHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSD
NF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagaaaaaaggagttcaacaggctttttagtgaaacagcgcgcatttttgaag
ctttatatgataacgatgacagagcaagagagactctatgggttaaagctgcttgaagta
cttcggtctgaatttaaagagattggttttaaaccaaatcatacagaagtataccggtct
ttgcatgagcttcttgatgacgggatactaaaacaaattaaagtaaaaaaagaaggggct
aagctccaggaagtcgtcctctatcaatttaaagattacgaagctgccaagctatataaa
aaacagctgaaggtagagctggatcgctgtaaaaaactgattgaaaaagctctctcagat
aatttttaa

DBGET integrated database retrieval system