KEGG   Bacillus subtilis subsp. subtilis 168: BSU18500Help
Entry
BSU18500          CDS       T00010                                 

Gene name
fabG
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase GDP_Man_Dehyd DUF1776 DUF2452 Shikimate_DH E3_UFM1_ligase
Motif
Other DBs
NCBI-GeneID: 940090
NCBI-ProteinID: NP_389732
Pasteur: BG11048
BSORF: BG11048
UniProt: P14802
Position
complement(2018554..2019270)
Genome map
AA seq 238 aa AA seqDB search
MQSLQHKTALITGGGRGIGRATALALAKEGVNIGLIGRTSANVEKVAEEVKALGVKAAFA
AADVKDADQVNQAVAQVKEQLGDIDILINNAGISKFGGFLDLSADEWENIIQVNLMGVYH
VTRAVLPEMIERKAGDIINISSTAGQRGAAVTSAYSASKFAVLGLTESLMQEVRKHNIRV
SALTPSTVASDMSIELNLTDGNPEKVMQPEDLAEYMVAQLKLDPRIFIKTAGLWSTNP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaagtttacaacataaaactgcactaatcacaggcggaggcagaggaattggccgc
gctactgctctggcgcttgccaaagaaggcgtgaatatcgggttaattggccggacttcc
gctaatgtagaaaaagtggctgaagaagtcaaagcgcttggtgtaaaagctgcatttgct
gctgcagatgtaaaagatgccgatcaggttaaccaagctgtagctcaagtgaaggaacag
ctcggtgatatcgatatcctcattaataatgccggcatcagcaaatttggcggtttctta
gatctgtcagctgatgagtgggaaaatattattcaagtcaacctaatgggtgtgtaccat
gtcactcgcgcggtgcttccggaaatgatcgaacgcaaagccggagacatcattaatatt
tcatctacagcgggccaaagaggagctgctgtaacaagtgcttacagcgcttctaaattt
gccgttctcgggttaacagagtctcttatgcaagaagtgagaaaacataatatcagagtc
agcgcgttaacgccgagcactgtcgctagtgatatgtctatcgaattgaacttaacagac
ggtaatcctgaaaaagttatgcagcctgaggatcttgctgagtacatggtggcacaactg
aaattagatcctcgtattttcatcaaaacagcgggattatggtcaacaaatccttaa

DBGET integrated database retrieval system