KEGG   Bacillus subtilis subsp. subtilis 168: BSU18510Help
Entry
BSU18510          CDS       T00010                                 

Gene name
yoxC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF948 DUF1664 Spore_III_AB Atg14 Mod_r YabA DUF4618 MctB OSTbeta GAS 7TM_GPCR_Srh CENP-F_leu_zip Chordopox_G3 GCN5L1 PepSY_TM_like_2 HAUS6_N SlyX DUF2730 DASH_Dad2 DUF4446 DivIC
Motif
Other DBs
NCBI-GeneID: 940083
NCBI-ProteinID: NP_389733
Pasteur: BG11047
BSORF: BG11047
UniProt: P28670
Position
2019421..2019726
Genome map
AA seq 101 aa AA seqDB search
MIIVYISLAVLAVSIIFLGVTVIQNKKKIDPALKELSSVTQAMQKQIEGLKTETELLTQK
QKKIQQDVQIKKYTLQQTAAEVKEVPQAVKEVWQAGHFNSR
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgattatagtttatatcagtcttgcagtattagcagtttctattatcttcttaggagtt
accgtgatccaaaacaagaaaaaaatagaccccgcactaaaggagctttcctctgttacg
caggctatgcaaaaacaaatcgaaggattaaaaacagaaacagagctgctgacgcaaaaa
caaaagaagattcagcaggatgtccaaataaaaaaatacacgcttcagcagaccgcagct
gaagtgaaagaagttccccaagcagtcaaagaggtgtggcaggcaggacattttaatagc
agataa

DBGET integrated database retrieval system