KEGG   Bacillus subtilis subsp. subtilis 168: BSU18520
Entry
BSU18520          CDS       T00010                                 

Gene name
yoxB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 940087
NCBI-ProteinID: NP_389734
Pasteur: BG11046
BSORF: BG11046
UniProt: P28671
Position
2019797..2020567
AA seq 256 aa
MIINRSCLKEFAEKVHFLPSSLTKSDLLTDPFRLHQENELGIYYSPHNEFINRDASLVIA
GITPGFSQMKTAYETAAESLLQGGTLEQMAVDTKIAAGFSGSMRHNLITMLDLCGLPQAF
GIQSAAKLFGELRHMLHTTSVIKYPVFIQQKNYTGYKPAITHSPILSTYAFGHFPAELNH
VTGPALLIPLGKAAETVCETLIRQHSLQNLICLNGFPHPSGANGHRLKQFSKNKEQLERQ
IRSFAALVDFAIEKRK
NT seq 771 nt   +upstreamnt  +downstreamnt
atgattataaaccgcagctgcttaaaagagttcgcagaaaaagtacattttcttccctct
tcacttacaaagtccgatttacttactgatccatttcgtctccatcaagaaaacgaactt
ggcatctactattcacctcataatgaatttatcaatcgggatgcctcgcttgtgattgcc
gggatcacgcctggtttttcccagatgaagacagcgtacgaaacagccgccgaaagcctg
ctgcaaggcgggactcttgagcaaatggcagtagacacaaaaatagcagcgggtttctcc
ggatcgatgagacataaccttattaccatgctggatttatgcgggctgccgcaagctttt
ggcattcaaagcgccgcaaagctttttggagaattacggcatatgctccatacaacttcc
gttattaaatatcctgtctttatccagcaaaaaaactataccggatacaaaccggctatc
actcattctcctatcctaagcacttatgcttttgggcacttccctgcagagcttaaccat
gtgacgggaccagctcttctcattccgttaggaaaagcggccgaaacagtgtgtgaaaca
ttgatcagacagcacagcctccagaatttgatttgccttaacggctttccccatccatca
ggcgcgaacggccatcgtttgaaacaattcagcaaaaacaaagagcaactagaaagacaa
attcgttcctttgctgcattggttgatttcgctatagaaaagaggaaataa

DBGET integrated database retrieval system