KEGG   Bacillus subtilis subsp. subtilis 168: BSU18530Help
Entry
BSU18530          CDS       T00010                                 

Gene name
yoaA
Definition
(RefSeq) N-acetyltransferase YoaA
  KO
K03790  [ribosomal protein S5]-alanine N-acetyltransferase [EC:2.3.1.267]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU18530 (yoaA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.267  [ribosomal protein S5]-alanine N-acetyltransferase
     BSU18530 (yoaA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  ribosomal protein modification factors
   BSU18530 (yoaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_4 Acetyltransf_1 FR47 Acetyltransf_8 Ribosomal_L30
Motif
Other DBs
NCBI-GeneID: 940097
NCBI-ProteinID: NP_389735
Pasteur: BG13472
BSORF: BG13472
UniProt: O34569
Position
2020611..2021144
Genome map
AA seq 177 aa AA seqDB search
MFPILETDRLILRQITDQDAEAIFACFSNDEVTRYYGLENMESIEQAISMIQTFAALYQE
KRGIRWGIERRDTKELIGTIGFHALAQKHRRAEIGYEIIPEHWRNGFASEVISKVVSYGF
SALGLSRIGAVVFTDNEASNRLLLKMGFQKEGVLRQYMYQNGTPYDTNVYSIVKPRE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctatattagaaacggatcggcttatacttaggcaaatcacagatcaggatgcg
gaagccatttttgcttgtttctcaaacgatgaggtgacacgctattatgggcttgaaaac
atggaatctatagaacaggccatttcaatgattcaaacgtttgctgccctctatcaagaa
aaacgcggtatacggtggggaattgaaagacgggacactaaagaactgatcggaacaatt
ggctttcacgctctggcccaaaagcataggcgcgcggaaatcggttatgaaatcatcccg
gagcattggcgaaacggatttgcatcagaagtcatttcaaaggtcgtatcttacggattt
tctgcccttggactgtcgcgtattggcgcagttgtatttaccgataatgaagcatcaaat
cgtctgcttctaaaaatggggtttcaaaaagaaggcgttttaagacagtacatgtatcaa
aatgggactccatatgatacaaatgtgtactctattgtgaaaccaagagaatga

DBGET integrated database retrieval system