KEGG   Bacillus subtilis subsp. subtilis 168: BSU18540Help
Entry
BSU18540          CDS       T00010                                 

Gene name
yoaB
Definition
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 940099
NCBI-ProteinID: NP_389736
Pasteur: BG13473
BSORF: BG13473
UniProt: O34864
Position
complement(2021223..2022467)
Genome map
AA seq 414 aa AA seqDB search
MLDKIGIPKRLAWGFLGVVLFMMGDGLEQGWLSPFLIENGLTVQQSASIFSIYGIALAIA
SWFSGVCLEAFGAKRTMFMGLLFYVIGTAAFIVFGFEQLNLPVMYVTYFVKGLGYPLFAY
SFLTWVIYRTPQSKLSTAVGWFWIAYCLGMFVFGAWYSSYAIKAFGYLNTLWSSIFWVCL
GAFFALFINKDRFEKKKRKRSETAEELLKGVTILFTNPRVLTGGIIRIINSIGTYGFPVF
LPMHMAQHGISTNVWLQIWGTIFLGNIVFNLIFGIVGDKFGWKNTVIWFGGVGCGIFTVL
LYYAPVFSGGSLAVVSVIGFIWGGLLAGYVPIGAIVPTVAGKDKGAAMSVLNLAAGLSAF
VGPALAWLFIGLVGAQGVVWIFAALYLASAVLTKCIHIPEEKAVKEETSPQYAS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgttggataaaataggaataccgaagcggcttgcctggggatttttaggggttgttttg
tttatgatgggagatggccttgaacaaggctggctcagtccttttttgatcgaaaacggg
ctcaccgttcagcagtccgcttccatttttagtatatacggaattgcgcttgccatagct
tcctggttttcgggtgtatgtctcgaagcatttggcgcaaaacgaacgatgtttatgggg
ctgttgttttatgtgatcggtacagctgcttttatcgtatttggatttgaacagctgaac
ctgccagtgatgtatgtgacttacttcgtaaaagggttaggttacccgctttttgcttat
tctttcttgacatgggtcatttacagaacaccgcaaagcaaactgagcactgctgtcggc
tggttttggattgcatattgcctcggcatgtttgtgttcggcgcttggtactcaagctac
gcgatcaaagcgttcggttatttgaatacgctttggagctctattttctgggtatgtctc
ggtgcattctttgcattgtttatcaataaagaccgttttgaaaagaagaaaagaaaaaga
tcagaaacagccgaggagcttttaaaaggggttacgattctatttacaaatccgcgcgtg
cttacaggcggaatcatcagaatcatcaacagcattggtacatatggttttccagtcttt
ttgccgatgcacatggcccagcatggaatttcaaccaatgtgtggctgcaaatttgggga
acgattttcctggggaacattgtgtttaaccttatcttcggtattgtcggcgataaattc
ggctggaaaaatactgttatttggttcggcggagtcggctgcggcattttcaccgtctta
ttatactacgcacctgttttctccggcggaagtttagcggttgtcagcgtgatcggcttt
atttggggcggtttgctggcaggctatgtgccgattggtgcaattgtgccgacggtggca
ggaaaagataaaggggcagccatgtctgtattgaatttagctgcaggtttatcagcgttt
gtcggccctgcactcgcttggctgttcatcggtctcgtcggcgcgcaaggtgtcgtctgg
atctttgcggccctttaccttgcaagtgcggtcttgacaaaatgtattcatatacctgag
gaaaaagcagttaaggaggaaacatctcctcaatatgcatcttaa

DBGET integrated database retrieval system