KEGG   Bacillus subtilis subsp. subtilis 168: BSU18550
Entry
BSU18550          CDS       T00010                                 

Gene name
yoaC
Definition
(RefSeq) sugar kinase YoaC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FGGY_N FGGY_C MreB_Mbl CDI RUN
Other DBs
NCBI-GeneID: 940100
NCBI-ProteinID: NP_389737
Pasteur: BG13474
BSORF: BG13474
UniProt: O34861
Position
complement(2022561..2024024)
AA seq 487 aa
MKKQKGYLVFDIGTGNARVAVVSVTGSVLTVEREDIEYSTETLYPDSRYFSPQVLWKQVM
NLAKRALSRSCDIDIIGLTSTSQRQGIVLIDQNGNPFLGLPNIDNRGREWEAGIPDWEEI
YSSTGRLPTALFSALKLYGLKQRQPSLWEKTASFTSISDWVTYQLSGILTYEPSQATETL
LFDVKQNTWSEEMCDIFGFSPSILPPLVRAGTAIGTIANEYASELGLSINAKVIAGGGDT
QLAVKSTGAGLEDIVIVSGTTTPITKITEDHGDTKHKAWLNCHTDQGHWLVETNPGITGL
NYQKLKQIFYPNETYEVMEEEISALAKEDHACVAALGSYLSAEKNALTRGGFLFDAPLSA
HLKRAHFVRAALEEIAFSIKWNFDILTEVTPFERDYVWVCGGGFQSKALTQYIADLLQKK
VYVQEGYHQASVVGAAVICNETFQLTEEMSANVRVIEPKDCQIELALYEEWKQTQRFFSG
SESKVLI
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgaaaaaacaaaaaggctatctcgtttttgatattggcacaggcaatgcgagggtagcg
gtcgtgagtgtaactggcagtgttctaacagttgaacgggaggacatcgagtattccaca
gagacgctttacccggacagccgttatttttctcctcaggtgctgtggaagcaggtgatg
aatttggcaaaacgtgcgctatcccgttcgtgtgatattgacatcattggtttgacatcg
acgagccaaagacaggggattgttttgattgatcaaaacggcaatccttttctcgggctg
ccgaacatcgataatcgcggccgagagtgggaggcgggcattcccgattgggaagagata
tacagcagcacaggccgcctgccaactgcacttttttctgcgctcaagctttatggatta
aaacagcgccagccctctttatgggaaaagactgcaagctttacaagcatcagtgattgg
gtgacgtaccaactgagcggaatattaacatatgaaccatcacaggcaacagaaaccctg
ctatttgatgtgaagcaaaacacttggtcagaagagatgtgcgacattttcggcttttct
ccatctatccttccgcctcttgtaagagcgggaacagcaattggaacgatagcaaatgaa
tatgcatccgaattaggcctttcaataaatgctaaggttatagcagggggcggggataca
cagctggctgtcaaaagcaccggagctggacttgaggacattgtcattgtatcagggaca
acaacgccaataaccaaaattactgaggatcatggcgacacaaaacataaagcctggttg
aactgtcatacggatcaagggcattggcttgtggaaacgaatccgggaattaccggcttg
aattatcaaaaattaaaacagattttttatccgaatgaaacgtacgaagtaatggaggag
gagatttctgcacttgcaaaagaagaccatgcatgtgtagcggctctcggctcttattta
tcggctgaaaagaatgcgttaacgagaggcggttttctttttgatgccccgctgtcagca
catttaaagagggcacattttgtacgtgcagcgctagaagagatcgcattttcaatcaaa
tggaactttgacattttaacagaggttactccgtttgaacgtgattatgtttgggtgtgc
ggagggggattccaaagcaaagcgctcactcaatatatcgcggatcttcttcaaaaaaag
gtctatgtccaagagggatatcatcaggcatctgtcgtcggtgctgcagtcatttgcaat
gaaacctttcaattaacggaggagatgtcagcaaatgtccgggtgatcgaaccgaaggac
tgtcagatagaattggctttatatgaggaatggaagcaaacacagcgctttttttcagga
tcagaaagcaaagtattaatttaa

DBGET integrated database retrieval system