KEGG   Bacillus subtilis subsp. subtilis 168: BSU18570Help
Entry
BSU18570          CDS       T00010                                 

Gene name
yoaE
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Motif
Other DBs
NCBI-GeneID: 940113
NCBI-ProteinID: NP_389739
Pasteur: BG13476
BSORF: BG13476
UniProt: C0SP82
Position
2025400..2027442
Genome map
AA seq 680 aa AA seqDB search
MRSFATQQNGIFKSVCSLDCPDQCGLLIHKKDGKIVKVQGDPDHPVTAGNICNKVRNMTE
RIYDEKRLTTPLKRTGAKGQAIFEPISWKEAIDTITSRWKQLIDEEGAESILPYSFYGNM
GKLTAEGMDRRFFYRMGSSQLERTICSKAGSEGYKYTMGISAGIDPEETVHTKLFIFWGI
NAVSTNMHQITIAQKARKKGAKIVVIDVHKNQTGRLADWFIPIKPGTDSALALGIMHILF
KENLHDEAFLSEYTVGYEELREHVKQYDPEKVSTITGVSTEDIYRLAKMYGETSPSFIRI
GNGPQHHDNGGMIVRTIACLPAITGQWLHTGGGAIKHNSGILEYNTNALQRPDLLKGRTP
RSFNMNQLGRVLLETDPPIRSLFIYGTNPAVVAPEANKVRQGLLREDLFTVVHDLFLTET
AAYADIVLPATSAFENTDFYTSYWHHYIQLQQPVIERYGESKSNTEVFRLLAEAMGFTDQ
ELKDSDEVLIRQALDHPDNPHLAEIDYDSLTKHSFMKAKREKPLFPGELPTPSGKIELYS
EKMKQDGFPALPTYTPLVTDNEHPFMYVPGPNHNFLNSTFSNNEKHIKLEKTPKLFINTK
DAEKHGIVDGAPVRIWNSRGECELTAAVGEQVLPGVVVSQGLWADEQGKKQLVNALTPDR
LSDMGGGATFFSGRVQIEKV
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgagatcttttgccacacaacaaaacggcattttcaaatccgtttgctcgctggactgc
ccggatcagtgcggattgttaatacataaaaaagacgggaaaatcgtaaaagtgcaagga
gaccctgatcatcctgtcacagctggaaacatatgcaacaaagtccggaatatgacggag
cgcatctatgatgaaaagcggctgactacaccgctcaaacgaacaggtgcgaaaggccaa
gcgatatttgaaccgatttcctggaaagaggcaatcgatacgatcacctcccgctggaaa
cagctgattgatgaagagggagctgaaagcatacttccttacagcttttacggaaatatg
gggaaattgacagctgaaggaatggaccgccgctttttttaccgcatggggtcaagccag
cttgaacggacgatttgcagcaaagcgggatctgaaggctataaatatacaatgggcata
agcgcgggaatcgatcctgaggaaaccgttcatacaaaactatttattttttggggaatc
aacgcggtcagcacaaatatgcaccaaattacgatcgcccaaaaagcgcgaaaaaaaggt
gccaaaattgtcgtgatcgatgtgcataaaaatcaaacaggacgtcttgcagattggttt
atcccaataaaaccgggaaccgacagtgcacttgctcttggcatcatgcacattttattt
aaagaaaaccttcatgatgaagcatttctgtccgagtacacggttggctatgaagagctc
cgtgaacacgtgaaacaatatgatcctgaaaaggtatcgacgatcaccggtgtcagtacc
gaagatatttaccgactggcaaaaatgtacggggaaacctccccttcttttatcagaatc
ggaaacggaccccagcatcacgataacggggggatgattgtaaggacgattgcctgtctt
ccggcgatcaccggccaatggctgcacacagggggcggcgcaattaagcataacagcgga
attttagaatataacacaaatgccttgcagcggcccgacttattgaaagggcgcaccccg
aggtcgtttaatatgaatcagcttggcagggtgcttttggaaacagacccgccgattcgc
tctctatttatttacggaacgaaccctgccgtcgtcgcgcccgaagcaaacaaagtcaga
cagggcttgctgcgggaagacttgtttactgtggttcatgatttgtttttaacggaaacg
gctgcatatgcggacattgtactgcctgcaacatccgcttttgaaaatactgatttttac
acctcctactggcaccattacattcagcttcagcagccggtgattgagagatatggggaa
agcaagtctaacactgaggttttccgattactggctgaagccatgggattcacagaccag
gagcttaaagattcagatgaagtattaatccgccaggcgcttgaccatccagataatccg
catttggcagagattgattacgattcacttactaagcattcatttatgaaagcgaaacgt
gaaaagccgctgtttccgggcgaacttccaacgccaagcggaaaaatagaattatattca
gaaaaaatgaaacaagacggcttccctgctttaccgacatatacacctcttgtaaccgat
aatgaacatccgtttatgtatgttccggggccaaaccataatttcttaaactcaacattt
tccaataatgaaaaacacatcaagcttgaaaagacgccaaagctctttatcaacacaaaa
gatgctgaaaaacacggaatcgttgatggggcacctgtacgaatttggaacagccgggga
gaatgcgagctgaccgctgcagttggagaacaagtgctgccaggtgtcgttgtcagccaa
ggattatgggcggatgaacaaggaaaaaaacagcttgtaaacgcgctaaccccagatcgc
ttgtccgatatgggcggcggcgccacctttttttcaggccgtgtacagattgaaaaggtt
tga

DBGET integrated database retrieval system