KEGG   Bacillus subtilis subsp. subtilis 168: BSU18580Help
Entry
BSU18580          CDS       T00010                                 

Gene name
yoaF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LAGLIDADG_3
Motif
Other DBs
NCBI-GeneID: 940103
NCBI-ProteinID: NP_389740
Pasteur: BG13477
BSORF: BG13477
UniProt: O31829
Position
2027509..2027802
Genome map
AA seq 97 aa AA seqDB search
MDVFLGIGIALAGYFIGEGLKQRNQTKGNEQNDIFLIKERDIYFYIGLFLGITTTEAKQL
AGDMADLPYIEINGKKYVQKHMLKDWTFTLVEKHQGE
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggacgtttttttaggaattggtattgctttggctggatattttatcggtgaaggctta
aagcagaggaaccaaaccaaaggtaatgaacaaaatgatatcttcctaataaaagaacgg
gatatttacttttacattggactttttttaggaataacaacgactgaagcaaaacagtta
gctggagacatggcagacctgccttacatcgaaataaacggaaaaaaatatgtccagaaa
catatgttaaaagattggacattcacattagttgaaaaacatcagggtgaataa

DBGET integrated database retrieval system