KEGG   Bacillus subtilis subsp. subtilis 168: BSU18590
Entry
BSU18590          CDS       T00010                                 

Gene name
yoaG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UPF0715 PalH DUF1129
Other DBs
NCBI-GeneID: 940105
NCBI-ProteinID: NP_389741
Pasteur: BG13478
BSORF: BG13478
UniProt: O31830
Position
complement(2028175..2028579)
AA seq 134 aa
MKKIASYYLMTLGLSSLTFGLLLGFYSFVMYGDMIIALFTAAIALLYGFVVYGLFAVPLQ
MKLQKKARTFNVMYLLIYSVVAFIAAFLFFVINEPASIAWTLQSYFYYMLSIAAAVIYWL
WDSLILYKRTASGV
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaaaaaaatcgcatcatattatttaatgacattagggctatccagccttacatttggt
ttgttattagggttttattctttcgttatgtatggcgatatgataattgcattgtttacg
gcagcaattgctttattatacggttttgtggtgtatggcctttttgctgttccgctccaa
atgaagttgcagaaaaaagcgagaactttcaatgtcatgtacctattgatttacagtgtg
gttgcttttatcgcagctttcctgttttttgttatcaatgaacctgcgtcaatagcatgg
acattgcaatcgtacttttattatatgttaagtattgcggctgcagtgatttactggtta
tgggattctctgatcctttataaacgtacagcttccggtgtatag

DBGET integrated database retrieval system