KEGG   Bacillus subtilis subsp. subtilis 168: BSU18600Help
Entry
BSU18600          CDS       T00010                                 

Gene name
yozQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4025
Motif
Other DBs
NCBI-GeneID: 2914173
NCBI-ProteinID: YP_054581
Pasteur: BG14189
BSORF: BG14189
UniProt: Q7WY68
Position
2029020..2029313
Genome map
AA seq 97 aa AA seqDB search
MTQKNGADRPDDYKRFSSLDKEYDFQQSIRSNTETESVNTETQTHNKENKNDTTDVAGKY
FEPSDYKGSTQLEKGLAETHEQVSDDYFEGTIDQNLD
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaaaaaaacggtgcagacagacctgatgattataaaagattttcttcattagac
aaggaatatgattttcagcaatctatacgcagcaatactgagacagaaagtgtaaacact
gaaacacaaactcataacaaagaaaacaaaaatgacacaacagatgttgccgggaaatac
tttgagccctcagattataaaggaagcacgcaattagaaaaaggattggctgaaactcat
gaacaggtcagcgatgactattttgaagggacaatcgatcaaaatttggactag

DBGET integrated database retrieval system