KEGG   Bacillus subtilis subsp. subtilis 168: BSU18610
Entry
BSU18610          CDS       T00010                                 

Gene name
yoaH
Definition
(RefSeq) methyl-accepting chemotaxis protein YoaH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MCPsignal HAMP CHASE3 4HB_MCP_1 DUF948 Spore_III_AB HAMP_2 LapA_dom GIT_CC LepB_GAP_N
Other DBs
NCBI-GeneID: 940110
NCBI-ProteinID: NP_389742
Pasteur: BG13479
BSORF: BG13479
UniProt: C0SP89
Position
complement(2029429..2031114)
AA seq 561 aa
MKVKTKLLGIISILVVSIIGIGGSSVFMISSTVKKNEELKDKMEFQKEIKHIQYELTGLS
NDERGFLITRDKEYDEGMKGKADDVLKSLDRVNDLIDEEKYQSNIEDIKTSFTQYRALNQ
QVVTAYSSNPKKAETIHFGEERTIRKEGVAPAVNKLSDRLDQEVEDLKDEIQGNGKMSQS
LIIIVTGISVILGIVLSIMLLKSIMVPLRSINKQLEEIAHGEADLTKKVIVKNKDEFGQL
AQSFNSFTHSLTQIVKQISSSSEQVAASSEELSASAEESKSTSEHISRAMQMAADSNVKQ
SSMTEKSAESITELLDSISSVASNTGNIADLSSSMRDKAEIGSKSVNKMLDQMKFIDKSV
DSAGNGLQTLVASTAEISDISSLITTISEQTNLLALNAAIEAARAGEQGKGFAVVAEEVR
KLADETNKSANHIQSVVATIQNESIETVNNIKVVQENVSSGIVLSQETTGNFNEILNLVE
QVTSQIQEVAAATQQLTSGVEVIQHTVHTLAAGTKETSANTEAVANSSQEQLHSMGEISY
AAESLSQLAEELQTVINRFKY
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgaaagtgaaaacaaaattgctggggattatatcaatattagttgtttcaattattgga
attggaggctcctcagtatttatgatttcttctactgtgaaaaagaatgaagaacttaaa
gacaaaatggaattccaaaaagagataaaacacatccaatatgaattgaccgggttatca
aatgatgaaagaggcttcttgattaccagagacaaagaatacgacgagggtatgaaggga
aaagcagacgatgtcttaaagagccttgaccgggttaatgacttgattgatgaagagaag
tatcaatccaatattgaagacattaagacaagttttactcagtatagagctttgaatcag
caagtagtaacagcctactcttcaaatcctaaaaaagcagaaaccatccattttggagaa
gaaagaacaataagaaaagaaggcgtagctccggctgtcaataagctgtctgatcgcctg
gatcaagaggtagaggatctaaaggatgaaatacagggcaatgggaaaatgagtcaatcg
ctcattatcattgtcacagggatatcagtaatattaggcattgttctaagcataatgctg
ttaaagtccattatggtgccactaagaagcataaataagcagctggaggaaattgcacac
ggcgaggctgatttaaccaaaaaagtcattgtgaaaaataaagatgaatttggccagctt
gcccaatcttttaattcttttactcattcattaactcaaattgtgaagcagatcagcagc
tcatctgaacaagtcgccgcttcctctgaagaattatcggcaagcgcggaagaatcgaaa
tcaacatctgaacatatttcacgagccatgcagatggctgccgacagcaatgtgaagcaa
agctcaatgacagaaaagagcgcagaatccatcactgaattattagacagtatatcatca
gtcgcttcaaatacagggaacatagcggatctttcttcttcgatgagagacaaggctgaa
ataggctctaagtccgtcaacaagatgttagaccagatgaaattcattgataaatctgta
gattcagccggcaatggattgcaaacattggtagcgagcacagcagaaatcagcgatatc
tcttcgcttatcacgacgatttcagagcagacaaatttgttggcactaaatgcagcgatc
gaggcggccagagccggagagcaaggaaaaggatttgctgtggtggcagaagaagttcgg
aagttggcggatgaaacaaataaatctgcaaaccacatccaatcggtggtagcgaccatc
caaaacgaatcgatagaaacggtaaataatattaaagttgttcaagaaaatgtgagctca
ggtattgttctttctcaagagacaacaggaaatttcaatgaaatactgaacctggtggaa
caggtcacttctcaaatacaagaagttgcagcagcaactcaacagcttacttcaggcgtt
gaagtgattcagcacacagttcatacattggctgctggtacaaaagaaacgtcagcaaat
acagaagcggttgcaaattcatcacaggaacagcttcattcaatgggggaaatctcctat
gccgcagaatctctatctcagttggcagaagaacttcaaaccgtcattaatcgttttaaa
tattaa

DBGET integrated database retrieval system