KEGG   Bacillus subtilis subsp. subtilis 168: BSU18620Help
Entry
BSU18620          CDS       T00010                                 

Gene name
yoaI
Definition
(RefSeq) 4-hydroxyphenylacetate 3-monooxygenase
  KO
K00483  4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00350  Tyrosine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BSU18620 (yoaI)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     BSU18620 (yoaI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB_N HpaB PheRS_DBD2
Motif
Other DBs
NCBI-GeneID: 940107
NCBI-ProteinID: NP_389743
Pasteur: BG13480
BSORF: BG13480
UniProt: C0SPC0
Position
2031439..2032890
Genome map
AA seq 483 aa AA seqDB search
MGIINGKEFIDRLNKLENEIWYDGEKIKGNISEHPAFKGIIKTKSSLYELQTKDELIHEM
TYCLPGDHNRIGLSYLQPKTKNDLKKRRTMIEHWARHTHGMMGRSPDYMNTVMMSFASSA
ELLKDKENCFPEHILDMYEQAAKHDLSFTHTFITPQVNRSQSYFGLSEKPISAKVIDRTE
KGLMIHGARLLATQGGLTDEILVFSAPKFFFETDEAYAFSIPSNTKGVKFITRESFVLSD
SSFNHPLSSRYEEMDSIVVFDHVLVPWNRVFFYDNVEAAKDFMTKSSFHAFTFHQVVIRQ
MIKIEFLLGVAQLLVDTINVSEYQHIQEKLSEIIVGLETIKALIDKSENDAQLDEFGYMR
PCLIPLQVISTIIPKLYPRFTEIIQLIGASGMVTLPTENAFDSEIREDLDQYLQATNTNA
EERVKIFRLAWDLTMSSFGTRQTHYERYFFGDPIRISSRLYTSYPKQEQLNMIKTFLHAD
TEH
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggggatcatcaatggtaaagaattcattgaccgattgaataaactagaaaacgaaata
tggtatgatggcgaaaaaataaagggtaacatttctgagcatcctgcatttaaaggaata
atcaaaacaaaaagctcactttatgaattgcaaacaaaggatgagttaatacatgaaatg
acttattgccttcctggagatcataatcgaatcggcctttcctatctccagcctaaaaca
aaaaatgatttgaaaaaaagaaggaccatgattgaacattgggctagacatactcatgga
atgatggggagaagtccggattacatgaatacggttatgatgagctttgcttcgtcagcg
gagcttctaaaagataaagagaattgctttcctgaacatatactagatatgtatgaacaa
gctgctaagcatgacctttcctttacccatacattcattactccgcaagtgaaccggtca
cagtcctattttgggctaagtgaaaaaccgatatctgctaaagtcattgatagaaccgaa
aaaggtttaatgattcatggcgcacgactgcttgccacacaaggcgggttgaccgatgaa
atcttggttttttcagcgcctaaatttttctttgaaacagatgaagcttatgctttttca
atcccttctaatacaaaaggcgtaaaattcatcacaagagaatcatttgtattaagcgac
tcttcctttaatcatcccttaagctcaaggtatgaagaaatggattcaattgtggttttt
gatcatgtgttagtgccgtggaatcgtgtgtttttttacgataatgtggaagcagctaaa
gattttatgacaaaaagctcttttcatgcctttacctttcaccaggttgtcattaggcaa
atgataaaaattgaatttctattaggtgttgcacagcttcttgtcgacaccattaatgtt
tccgaatatcagcacatccaagaaaagctctcagaaatcattgtgggattggaaacaatc
aaagccctcattgacaaatcggaaaatgatgctcagttagatgaattcggctatatgcgc
ccctgtttaattcctcttcaagtcatcagtacgatcattcctaagctatatcctcgattt
actgaaatcatacaattaattggagctagcggaatggtgacactgcctaccgaaaatgca
tttgactcagagatacgggaagatcttgaccaatatcttcaagcaaccaatacaaatgct
gaagaacgtgtgaaaattttccgtttggcatgggatttaacaatgagttcattcggaact
agacaaactcactacgaaagatattttttcggagatcctattcggatttcaagcaggctg
tataccagttatccaaagcaggagcagttgaacatgattaaaacatttttacatgcagat
acagaacattga

DBGET integrated database retrieval system