KEGG   Bacillus subtilis subsp. subtilis 168: BSU18630
Entry
BSU18630          CDS       T00010                                 

Gene name
exlX
Definition
(RefSeq) expansin-YoaJ
  KO
K20628  expansin
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    BSU18630 (exlX)
SSDB
Motif
Pfam: DPBB_1 Expansin_C
Other DBs
NCBI-GeneID: 940108
NCBI-ProteinID: NP_389744
Pasteur: BG13481
BSORF: BG13481
UniProt: O34918
Structure
PDB: 

Position
complement(2032927..2033625)
AA seq 232 aa
MKKIMSAFVGMVLLTIFCFSPQASAAYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITA
INPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKD
GKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMD
YNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaaaaagatcatgagtgcatttgttggtatggttttgttgacgatcttctgtttttcc
ccgcaagcttcggcagcatatgacgacctgcatgaaggttatgcaacgtatacagggtca
ggctattcaggaggagctttcctgctggatcccattccttccgatatggagattactgca
ataaatccggcggatctcaattacggaggagtaaaagcggcacttgccggctcttatttg
gaagttgaagggccaaaagggaaaacaaccgtatatgttactgatctttatcccgaaggc
gctcggggagctcttgatctgtcacctaatgccttccgtaaaatcggcaatatgaaagac
ggaaaaatcaatattaaatggcgtgttgtcaaagccccaatcaccggcaatttcacgtac
cggatcaaagaaggcagcagcaggtggtgggcagcaatccaagtcagaaatcacaagtat
cctgttatgaaaatggaatatgaaaaggatggtaagtggatcaacatggagaaaatggac
tataaccattttgtgagtacgaatttaggtactggctctctcaaagtcagaatgactgac
atccgcggaaaagttgtgaaagacaccattccaaagctgcctgaaagcggaacgtccaaa
gcctatacagtaccgggccatgttcagtttcctgaataa

DBGET integrated database retrieval system