KEGG   Bacillus subtilis subsp. subtilis 168: BSU18640
Entry
BSU18640          CDS       T00010                                 

Gene name
yoaK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1275
Other DBs
NCBI-GeneID: 940007
NCBI-ProteinID: NP_389745
Pasteur: BG13482
BSORF: BG13482
UniProt: O34343
Position
complement(2033895..2034572)
AA seq 225 aa
MTAAAYRNTLLSLLCLTAGIVDVIGYLSLGHVFTANMTGNIVLLGLAIGKSIQVTVFNSL
TALIGFICGVIIATLMVGKAENTLWPSAVTKALALEAFILFVFACLSFYRAFVPVHILII
LMSISMGIQTTAAKKLGIAGISSTVLTGTLASLLEDISGRLFFKKQKKTFLRDTVLRALA
IILYCVGAIIVALAEPDFYHFIIWVPIVLIFGIMMTAKLKLSGEK
NT seq 678 nt   +upstreamnt  +downstreamnt
ttgactgcagcagcttatcgaaacaccttgctatcacttttatgtttaacagctggaatc
gtggatgtaatcgggtatttaagcctgggacatgtgttcacagctaatatgactggaaac
attgtattattggggttagctatcggcaaatccattcaggtcactgtttttaattccttg
actgcgctaatcggatttatatgcggcgtgatcattgctacattgatggtcggaaaggcg
gaaaataccctttggccttctgctgtgacaaaagccctcgcacttgaagcattcattttg
tttgtctttgcttgtctttctttttaccgggcatttgttcctgtgcacattctaattata
ctcatgagcatttctatggggattcaaactacagcagcaaaaaaactggggattgcaggt
atttcttcaactgtgttgaccggcactttggcttctcttttagaggatatatccggccgt
ttgttttttaagaagcaaaagaagactttcttaagagatactgtgttaagagcactggct
attattttgtattgtgtaggggctattattgttgctctggctgagcctgatttttatcac
ttcattatttgggttccgattgtgctgatctttggcatcatgatgacagctaagttgaaa
ctgagcggggaaaaatag

DBGET integrated database retrieval system