KEGG   Bacillus subtilis subsp. subtilis 168: BSU18650
Entry
BSU18650          CDS       T00010                                 

Gene name
pelB
Definition
(RefSeq) pectin lyase
  KO
K01732  pectin lyase [EC:4.2.2.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU18650 (pelB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.10  pectin lyase
     BSU18650 (pelB)
SSDB
Motif
Pfam: Pectate_lyase_4
Other DBs
NCBI-GeneID: 940111
NCBI-ProteinID: NP_389746
Pasteur: BG12643
BSORF: BG12643
UniProt: O34819
Position
2034745..2035782
AA seq 345 aa
MKRLCLWFTVFSLFLVLLPGKALGAVDFPNTSTNGLLGFAGNAKNEKGISKTGTTGGKNG
QIVYIQSVNDLKTHLGGSTPKILVLQNDLSASAKTTVTIGSNKTLVGSYAKKTLKNIYLT
TSSAFGNVIFQNLTFEHSPQINGNNDIQLYLDSGMNYWIDHVTFSGHSYNASGSDLDKLV
YIGKSADYITISNSKFANHKYGLILGYPDDSQHQYDGYPHMTIANNYFENLYVRGPGLMR
YGYFHVKNNYSNNFNQAITIATKAKIYSEYNYFGKGSEKGGILDDKGTGYFKDIGSYPSL
NKQTSPLTSWNPGSNYSYRVQTPEYTKEFVTKYAGSQSTTLVFGY
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaaacgactttgtttatggttcaccgtctttagcttgtttttggttctcttgcctgga
aaagcattaggtgcagtcgattttccgaatacctcaacaaatggccttttaggttttgcc
ggaaatgccaaaaatgaaaaaggcatctctaaaacgggcacaacgggtggaaaaaacggg
cagattgtttacattcaaagcgtaaatgatttaaaaacccatctaggaggatccactccg
aaaattttagtgcttcaaaatgatctttccgcatctgcgaaaacaacagttaccattggc
tcaaataaaacactcgtgggctcttacgcgaaaaaaacgctgaaaaatatttatttaaca
acttcatcagcttttggaaatgtcatttttcaaaatttaacgtttgaacacagtccgcag
attaacggaaataatgatatccagctttatttagattccggtatgaactattggattgat
cacgtcacattctcaggtcatagctataatgcaagcggaagcgatttggacaaactcgtg
tatatcggaaaatccgcagattatatcacgatcagcaactcaaaatttgcgaatcataaa
tacggtttgattttaggatacccggatgattctcagcatcaatatgacggctacccccac
atgacaatcgccaataattattttgagaacttgtatgttagaggcccaggtctgatgaga
tacggttactttcatgttaaaaacaattacagcaataattttaaccaggcgattacaatt
gctacaaaagcaaaaatatattccgaatataattactttgggaaaggcagtgaaaaaggc
ggcatccttgacgacaagggcactggttatttcaaagacataggcagctatccatcactc
aacaagcaaacctctccgctgacttcttggaatcctgggtcaaactatagctatcgtgtc
caaacgccggaatatacaaaagaatttgtcacgaaatatgccggatcacaaagtacaact
ctggtatttggctactga

DBGET integrated database retrieval system