KEGG   Bacillus subtilis subsp. subtilis 168: BSU18660Help
Entry
BSU18660          CDS       T00010                                 

Gene name
yoaM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRAP
Motif
Other DBs
NCBI-GeneID: 940112
NCBI-ProteinID: NP_389747
Pasteur: BG13483
BSORF: BG13483
UniProt: O34906
Position
2036039..2036722
Genome map
AA seq 227 aa AA seqDB search
MCGRFTLYSAFDDIIDQFDIDQFFPKGEYQPSYNVAPSQNILAIINDGSNNRLGKLRWGL
IPPWAKDEKIGYKMINARAETITEKPAFRRPLVSKRCIIPADSFYEWKRLDSKTKIPMRI
KLKSSALFAFAGLYEKWSTHQGYPLYTCTIITTEPNEFMKDIHDRMPVILAHDHEKEWLN
PKNTSPDYLQSLLLPYDADDMEAYQVSSLVNSPKNNSAELLDAENHM
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaggtttactttgtactctgcatttgatgatattattgaccagtttgacatc
gatcaattttttcctaaaggtgaataccagccaagctataatgtcgcaccatcacaaaac
atccttgcaatcatcaatgatggatcaaataatcgcttaggcaagcttagatggggactt
attccaccttgggcaaaagatgaaaagatcggttataaaatgatcaatgctcgagccgaa
acaattaccgagaaaccggcctttcgaagaccgcttgtcagcaaacgctgcatcatacca
gcagacagtttttatgaatggaaacggcttgattccaaaaccaaaatcccaatgcggatc
aaattgaaatcatctgctctttttgcgtttgctggcttatatgaaaagtggagcacacat
caaggataccctctttatacctgcaccatcataacaactgagcctaatgagttcatgaaa
gatatacacgaccgaatgccggttatattggcccatgatcatgaaaaggagtggcttaac
cccaaaaatacaagccctgattatctgcaaagtttgctgctgccttatgatgctgatgac
atggaagcataccaggtttcatcattagtaaattcacccaaaaataattcagctgagctt
cttgatgcagaaaatcatatgtag

DBGET integrated database retrieval system