KEGG   Bacillus subtilis subsp. subtilis 168: BSU18660
Entry
BSU18660          CDS       T00010                                 

Gene name
yoaM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SRAP
Other DBs
NCBI-GeneID: 940112
NCBI-ProteinID: NP_389747
Pasteur: BG13483
BSORF: BG13483
UniProt: O34906 A0A6M4JIT9
Position
2036039..2036722
AA seq 227 aa
MCGRFTLYSAFDDIIDQFDIDQFFPKGEYQPSYNVAPSQNILAIINDGSNNRLGKLRWGL
IPPWAKDEKIGYKMINARAETITEKPAFRRPLVSKRCIIPADSFYEWKRLDSKTKIPMRI
KLKSSALFAFAGLYEKWSTHQGYPLYTCTIITTEPNEFMKDIHDRMPVILAHDHEKEWLN
PKNTSPDYLQSLLLPYDADDMEAYQVSSLVNSPKNNSAELLDAENHM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtgcggcaggtttactttgtactctgcatttgatgatattattgaccagtttgacatc
gatcaattttttcctaaaggtgaataccagccaagctataatgtcgcaccatcacaaaac
atccttgcaatcatcaatgatggatcaaataatcgcttaggcaagcttagatggggactt
attccaccttgggcaaaagatgaaaagatcggttataaaatgatcaatgctcgagccgaa
acaattaccgagaaaccggcctttcgaagaccgcttgtcagcaaacgctgcatcatacca
gcagacagtttttatgaatggaaacggcttgattccaaaaccaaaatcccaatgcggatc
aaattgaaatcatctgctctttttgcgtttgctggcttatatgaaaagtggagcacacat
caaggataccctctttatacctgcaccatcataacaactgagcctaatgagttcatgaaa
gatatacacgaccgaatgccggttatattggcccatgatcatgaaaaggagtggcttaac
cccaaaaatacaagccctgattatctgcaaagtttgctgctgccttatgatgctgatgac
atggaagcataccaggtttcatcattagtaaattcacccaaaaataattcagctgagctt
cttgatgcagaaaatcatatgtag

DBGET integrated database retrieval system